KEGG   Paenibacillus polymyxa E681: PPE_00621Help
Entry
PPE_00621         CDS       T01319                                 

Definition
O-glycosyl hydrolase (EC:3.2.1.45)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ppy00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ppy00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(679839..681182)
Genome map
AA seq 447 aa AA seqDB search
MSNQTIQWFSTSKAKAWHSQAQHLTHTQESANLTFTREAHQLVEGFGGCFNELGYVALNH
LEKDERDRVLHSFFHPEGEHKFAICRLPIGASDYALEWYSHNETDGDVEMKHFSIERDQQ
YLIPFIREALQLNPDLKLFASPWSPPTWMKSPKSYNYGTLRWEKDILKAYALYFVKFVQA
YRKAGITIHQIHVQNEVIADQKFPSCVWTGEQLREFIRDYLGPAFEEHGLDTEIWLGTIN
APDPWEELMKKTSTGFDEYAHTVLSDPEAYKYIKGVGYQWAGKNAIQRTVASYPELRYMQ
TENECGNGENSWDYAKYVFNLYQHYFTNGVNAYIYWNMVLEPKGKSTWGWEQNSMITVDP
ADRKPVLNPEYYVMKHFSHFVLPGARRIGLRGSWTGNAVAFQNTDGQRVVVIANPFKESR
VLNLSLGETTHRLELEPDSFNTIVIPS
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatcaaaccattcagtggttttccacttccaaagctaaagcttggcattcccaa
gctcagcatttgacccatacccaagagagtgccaacctaacctttacgagagaagctcat
cagcttgtcgaaggctttggtggctgttttaatgaactgggttatgtggccctgaaccat
ttggaaaaggacgaacgagatcgggtgcttcattctttctttcatccagagggcgagcac
aaatttgcaatatgccgacttcctattggagcgagtgactacgcgttggagtggtacagc
cacaatgaaacagacggcgacgtggagatgaagcatttttccattgagcgtgatcagcaa
tatctcattccttttattcgggaagcgttacaactcaatccagacttgaagttgttcgct
tcaccctggagcccgccaacatggatgaaatcaccgaaatcctacaattatggcactttg
cgctgggaaaaggatattttgaaagcgtatgcattgtactttgtcaaatttgttcaggct
tatcgcaaggcaggtattacaattcatcagattcatgttcaaaatgaagtcattgccgat
cagaagttcccttcctgtgtatggaccggagagcaactgcgtgaatttattcgtgattat
ttgggccctgcttttgaggaacacggactggatacggaaatttggctgggcaccattaac
gcacccgatccgtgggaggaattaatgaaaaagacttcgaccggattcgatgagtatgcc
cataccgtgttgagtgaccctgaggcctacaaatatattaaaggcgtaggctaccagtgg
gcaggcaaaaatgccattcagcgcaccgttgccagctatcctgagcttcgttacatgcaa
acagaaaatgaatgcggtaacggagaaaactcatgggactacgccaaatatgtatttaat
ctgtaccagcactacttcaccaatggtgtgaatgcttatatttactggaatatggttttg
gaaccgaaaggtaagagcacatggggctgggagcaaaattcgatgattactgttgatcca
gcggatcgaaaacctgtcctgaatccagagtattatgtcatgaagcatttttctcatttt
gtattaccgggtgcccgacgcatcggacttcgtggctcatggactggaaatgcagttgct
tttcaaaatacagacgggcaaagggtggtagtcatcgccaatccgttcaaggaatcgcgt
gtgctgaatctgtctctcggtgaaacaacacaccgcttggagctggagccggattccttt
aatactatcgtgattccttcttaa

DBGET integrated database retrieval system