KEGG   Paenibacillus polymyxa E681: PPE_00639Help
Entry
PPE_00639         CDS       T01319                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PPE_00639
Enzymes [BR:ppy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     PPE_00639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
699185..701191
Genome map
AA seq 668 aa AA seqDB search
MKKLLYGVAYYDEYMPYDRLDQDIQMMKDAGINVVRIAESTWSTHEPQNGVFDFTSVDRV
LDAMHKAGIEVIVGTPTYAVPTWLVKEHPDVLATTPQGPGKYGARQIMDITNPVYLFHAE
RIIRKLIGRVSQHPAVIGFQTDNETKHYHTSGPNVQLQFVKYLRERFESLEELNRKFGLD
YWSNRINSWEDFPSVVGTINGSLGAAFSQFQRKLVTDFLAWQVALVNEYKREDQFVSQNF
DFEWRGHSFGVQPDVDHFAASQAFDVTGVDIYHPSQDDLTGIEISFGGDVARSTKNNNYL
VLETEAQAFTHWVPYPGQLRLQAFSHLASGANMVAYWHWHSIHNSFETYWKGLLSHDFEP
NPVYEEAQTIGKDFARLSPHLVNLKKKNKTAILVSNEALTSIDWFKFNMSSPLNYNDIVR
RLYDELYKLNIGTDIVHPGTESFDDYDLLIVPVLYAAPDALLEKLNRYVEKGGHVVYTFR
SGFTDEHVQVRTSRQPGVISEACGIHYSLFVEPKKVTLKNNPFEVAAEDNQVDTWMELIT
PTTAEVLAYYDHPHWGKYAAITQNRYGQGTATYIGCVVSPAVIRELFSSVAKKAGVWGLD
QETSYPIIVKSGTNELGRTIRYYFNYSEQAGSVVYPHGDGKELIGVRTVIQGQTLTLEPW
GVIIIEEA
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagctactgtacggtgttgcttattatgatgaatatatgccatatgaccgtttg
gaccaggatatccaaatgatgaaggatgcgggcatcaacgtggtgcggattgccgaatcc
acttggagtacacatgaaccgcaaaacggcgtatttgattttacttctgtggatcgggtg
ctggacgccatgcataaggcgggcatcgaagtcattgtggggacgcccacctatgccgta
cccacatggctggtgaaggagcatcccgatgtattggcgacaacgcctcaaggtccgggc
aaatatggagctcgccagattatggacataacgaacccggtgtacctgttccatgccgag
cgaatcatacgcaagctgatcggacgggtgagtcagcatccggcggtcattggctttcag
acggataatgagaccaagcattaccacacgagtgggcccaatgtgcaattgcaatttgta
aagtatttgcgggagcggttcgaatcgctggaggagctaaaccgcaaatttggtctggac
tactggagtaatcgcatcaatagctgggaggactttccttcggtggtcggaacgattaat
ggcagtttgggcgcagccttttcccaattccagcgcaagctggtgacggatttcttggca
tggcaggtcgcgctggtgaatgaatataagcgggaagaccaatttgtttcgcaaaacttt
gattttgaatggagaggtcattcctttggtgttcagccagacgtggatcactttgcggca
tcgcaagcctttgatgtgactggggtggatatttaccatccatcacaggatgacctgact
ggcattgaaatttccttcggtggcgatgtggcgcgttcgacgaaaaataacaactatcta
gtgctagaaacggaagcgcaggcttttacccactgggttccctatccggggcaattgcgt
ctgcaagcgttcagccatctggcttccggggccaatatggtggcatactggcactggcat
tccatccataattccttcgaaacctactggaagggtctgctcagccatgattttgaaccg
aatcctgtgtatgaggaagcacagaccatagggaaggattttgcaagattgtctccgcat
ctggtcaacctgaaaaagaaaaataaaacggcgattctggtcagcaacgaagcattgacg
tcgattgactggtttaaatttaatatgagtagccctttaaattacaatgacattgtacgc
cgtttgtatgacgagctgtataaactgaatatcggaacggatatcgttcatccaggtaca
gaatcgtttgacgactatgatctcttgatcgttccggttctctatgctgccccggatgca
ctactggagaagctgaaccgatatgtggaaaaaggtggtcatgtcgtatacacattccga
agtggatttaccgacgagcatgtgcaggtaagaacgtcccggcagccgggcgtgattagc
gaagcctgcggcattcattacagcttgttcgtggagccaaagaaggtgacgcttaagaat
aatccttttgaggtggcagcagaggacaatcaggtagatacgtggatggagctgattacc
ccgacgaccgccgaagtgttggcctattacgatcacccgcattggggaaaatatgccgcg
attacgcaaaaccgctatggtcagggaacagcgacctatatcggctgtgtcgtcagtccg
gcggtcatccgcgaactattcagctctgtagccaaaaaggcaggcgtatggggactggat
caggaaacatcttatccgatcattgttaaatccggcacgaatgagctgggacggacaatc
cggtactattttaactattccgaacaagcaggctcggtggtatatccacatggagacggc
aaggagttaatcggggtgcgtacagttatccaaggacagacgcttacattagagccttgg
ggtgttataattatcgaagaagcgtaa

DBGET integrated database retrieval system