KEGG   Paenibacillus polymyxa E681: PPE_00697Help
Entry
PPE_00697         CDS       T01319                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ppy00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ppy00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ppy00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
761079..763271
Genome map
AA seq 730 aa AA seqDB search
MAIYIDKEKLLFHLQGSNTSYVMQVIRGGYLSHLYWGKKIRNYRGSNKIIFMDRGFSPNP
DGEDRAFSLDTIPQEYPSFGNSDFRIPAYQLQLENGSTVTDFRYKEHRVFQGKPKLKGLP
STYVEDDGEVATLEIVLEDPLIDVKVVLSYSLYQKRDVITRSVRFENEGRQQLKLLRALS
ASVDFRDDEYELITLYGAHNNEKNIARRKILPGIQMVDSCRGASSPQQAPFMALVRKGTD
EEQGEVYAFNLVYSGNFTAQTQVDSYRNTRVTMGINPFDFTWLLEPEESFQTPEVVMVYT
ENGLGGMSRIYHDLYRNRLCRGPFRDKERPILINNWEATYFNFDADKIEQLAKEAQSVGV
ELFVLDDGWFGKRDDDNTSLGDWVVDRRKLPDGLPDLANRIRNLGLEFGLWFEPEMVSID
SDLYRKHPDWCIHVPDRPHTLGRNQLMLDLSRKEVCEYIIKSVSDILSDVSITYVKWDMN
RHMTDVGSAALPPERQRETAHRYILGLYHIMEELTSRFPHVLFESCSSGGGRFDAGMLYY
MPQTWTSDNTDAICRLKIQWGTSLVYPPITMGAHVSTVPNHQVGRITPLETRGYVAMAGN
LGYELDLTTLTVEEKEIVKKQIALYKEMRSLIQFGNFYRMINPFDENEAAWSFVSEDQTE
MAASYFKVLSQPAAAIKTLKFKGLNSDYVYRNVETGELFGGDELMHVGITLARVKQDFLG
MFWRFVKEDI
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atggctatatacatcgataaagagaagcttttattccatttacaaggcagcaatacaagt
tatgtcatgcaggttatacgaggtggttatttatcccatctgtattggggaaagaaaatt
aggaactatcgggggagcaataaaatcatctttatggatagaggattttcgcccaatccc
gatggcgaggatcgagccttttcactggataccatcccgcaagaatatccgtcatttggg
aatagtgatttcaggattcctgcgtatcagcttcaattggagaatggttctaccgtgacc
gattttcggtataaagaacatcgggttttccaaggcaaacccaaattgaaagggcttcct
tctacgtatgtagaggatgatggcgaagtagcaacactggaaatcgtccttgaagaccca
ttaattgatgtaaaggttgtactatcctatagcctatatcaaaagcgggatgtcattacc
cgttcagtccgtttcgagaatgaaggtcggcaacagctaaaactgcttagagcgttaagt
gctagtgtggattttcgtgatgatgaatacgaactcattaccttgtacggtgcgcataat
aatgagaaaaatatagcaaggcgaaaaattttacccggaattcaaatggtagacagctgc
cgtggagctagcagccctcaacaggcaccctttatggcacttgtaagaaaagggacagat
gaagaacagggtgaagtgtacgcctttaatctggtgtacagcgggaactttacggcccag
actcaggtagattcctatcggaacacaagagtcacgatggggattaatccttttgatttt
acatggctgcttgaaccggaggaatcctttcaaacgccagaagtggtcatggtatacacc
gaaaatggcttgggcggtatgtcgagaatttatcatgatttatacaggaacagattatgc
cgtgggccttttcgtgacaaggagcggccgatcctgattaataactgggaagccacctac
tttaactttgatgccgacaagattgagcagctggcgaaggaagctcaaagtgtgggagtg
gagctgtttgtattggatgatgggtggtttggaaaacgggatgatgacaatacttcatta
ggcgattgggtggtggatcgtcgcaaacttccagatgggttgccagatcttgcaaaccgc
atacgaaatctgggtctggagtttggtttgtggtttgaacctgaaatggtatccatagac
agcgatttatacagaaagcatcccgattggtgtatccatgtccctgatcgtccgcatacg
ttgggaagaaatcagcttatgttggatttatcgaggaaggaagtgtgtgagtacatcatt
aagtcggtttccgatattttatcggacgtttcaattacttatgtaaaatgggacatgaat
cgtcacatgacggatgtgggttcggcagccttgccacctgagagacagagggagactgcg
catcgttatatcctgggactctatcatattatggaagagcttacatcaagatttccccat
gtcttattcgagagctgttctagtggaggaggccgttttgatgctggcatgctctattac
atgcctcagacttggacaagtgataatacggatgccatttgccgactgaaaattcaatgg
ggaacaagtcttgtctaccctccgattaccatgggggcacacgtctccacggtacccaac
catcaagtgggcagaataactcccttggagacaagaggttatgtcgccatggccgggaat
ttaggatatgagctggatttgacgacattaaccgttgaggaaaaagaaatagtaaaaaaa
cagatagctttatataaagagatgagatcgctcattcaatttggaaatttttacagaatg
attaatccgtttgatgaaaatgaagccgcatggagctttgtgtcagaggatcaaacggaa
atggcggccagctatttcaaggttttatcccaacccgctgccgcgattaaaacgttaaaa
ttcaaaggtttgaattcagactacgtttatagaaatgtagaaaccggtgagctgttcggc
ggtgatgaattaatgcatgttggcataacgcttgccagggtgaagcaggactttttaggc
atgttctggagatttgttaaagaagacatctga

DBGET integrated database retrieval system