KEGG   Paenibacillus polymyxa E681: PPE_00889Help
Entry
PPE_00889         CDS       T01319                                 

Definition
hypothetical protein
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ppy00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ppy00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
965290..965931
Genome map
AA seq 213 aa AA seqDB search
MNNYNIPANALITVAGTVGVGKSTLTGALAGRLGFKTSLEQVDHNPYLEKFYHDFERWSF
HLQIYFLAERFKEQKNIFLSGGGFVQDRSIYEDTGIFAKMHADQGTMNPTDYETYTSLFE
AMVMTPFFPHPDVLIYLEGSLPSILSRIEERGREMEIQTERSYWEQMHRRYSNWINEFDA
CPVLRLNIDEYDVHDPASMDAILEEVGKVISKK
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
gtgaataattacaacattcctgcgaatgccctgattacggtagcgggtacagtgggtgta
ggtaaatccacgctgactggtgctttggccggacgccttggttttaaaacctctttggag
caggtcgatcataatccctatctggagaaattttatcacgatttcgaaagatggagcttt
catttgcaaatttattttctcgcggaacgcttcaaggaacaaaagaatattttcttgtct
ggtggaggctttgtgcaggatcgttctatttatgaggacacaggcatttttgcgaaaatg
catgccgatcagggaacgatgaaccctaccgattatgaaacgtatactagcctgtttgag
gcgatggtgatgacaccgtttttcccgcaccctgatgtattgatctatttggaaggcagc
ttgccctccatactgagtcggattgaggagcgtggtcgtgagatggagatccagaccgag
cgatcctattgggagcaaatgcatcgcagatattccaattggatcaacgaatttgatgcc
tgtcctgtactgcgtctgaacattgatgaatatgatgtacacgaccctgcttctatggat
gctattttggaagaagtaggaaaagtaatatcaaaaaaatag

DBGET integrated database retrieval system