KEGG   Paenibacillus polymyxa E681: PPE_00889Help
Entry
PPE_00889         CDS       T01319                                 

Definition
hypothetical protein
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PPE_00889
   00240 Pyrimidine metabolism
    PPE_00889
Enzymes [BR:ppy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     PPE_00889
    2.7.1.76  2'-deoxyadenosine kinase
     PPE_00889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
965290..965931
Genome map
AA seq 213 aa AA seqDB search
MNNYNIPANALITVAGTVGVGKSTLTGALAGRLGFKTSLEQVDHNPYLEKFYHDFERWSF
HLQIYFLAERFKEQKNIFLSGGGFVQDRSIYEDTGIFAKMHADQGTMNPTDYETYTSLFE
AMVMTPFFPHPDVLIYLEGSLPSILSRIEERGREMEIQTERSYWEQMHRRYSNWINEFDA
CPVLRLNIDEYDVHDPASMDAILEEVGKVISKK
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
gtgaataattacaacattcctgcgaatgccctgattacggtagcgggtacagtgggtgta
ggtaaatccacgctgactggtgctttggccggacgccttggttttaaaacctctttggag
caggtcgatcataatccctatctggagaaattttatcacgatttcgaaagatggagcttt
catttgcaaatttattttctcgcggaacgcttcaaggaacaaaagaatattttcttgtct
ggtggaggctttgtgcaggatcgttctatttatgaggacacaggcatttttgcgaaaatg
catgccgatcagggaacgatgaaccctaccgattatgaaacgtatactagcctgtttgag
gcgatggtgatgacaccgtttttcccgcaccctgatgtattgatctatttggaaggcagc
ttgccctccatactgagtcggattgaggagcgtggtcgtgagatggagatccagaccgag
cgatcctattgggagcaaatgcatcgcagatattccaattggatcaacgaatttgatgcc
tgtcctgtactgcgtctgaacattgatgaatatgatgtacacgaccctgcttctatggat
gctattttggaagaagtaggaaaagtaatatcaaaaaaatag

DBGET integrated database retrieval system