KEGG   Paenibacillus polymyxa E681: PPE_00923Help
Entry
PPE_00923         CDS       T01319                                 

Definition
beta-1,6-glucanase (EC:3.2.1.75)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    PPE_00923
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PPE_00923
Enzymes [BR:ppy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     PPE_00923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1006716..1008233
Genome map
AA seq 505 aa AA seqDB search
MKKLQKQRRTDIWLLIAAAAILVCAVLASMTIRNAPGPKAENNVNMWLTTPDPANRLTQQ
TPIRWDKDNSKENAANADTLTIEIKPDIHYQTIEGFGAAVSGSSAYLMNHGLSANQRDRL
LNDLFTASGIQLSYIRHTIGASDYSVDEQGQPGSYTYDDVATGKDYELNHFSIAKDRDVI
DVLKQILRRNQDLKIMGTPWTAPPWMKYGEQIYNGWYLDYTDSRVYQAYADYFVRYLQAY
ANEGIPIQAISIQNEPEFTTSKYPSMSMGAAEQANFIKQYLGPTLNRNHLSTHIIAFDHN
WDTGSEYAKTVLGNEQARSYTHGTAFHCYKGEPTAMTDVHHAFPDKPVYMTECSGGAWSL
GFGDDLSWDMSKLIIGAPRNWSQNVLFWNIALDPSGGPTNGGCDNCRGVVTIDPLSGAVT
KNVEYYAIGHASKFVRPGAVRIDSTHYSGSIETVAYRNPDGTLVLIAANTGENTKTFKVR
QGNKVFKSTLPSKSAATFQWNPTVS
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaactccaaaagcaacgacgtactgacatctggctgcttatagctgcagcagcc
attttggtctgtgcggtcctggccagtatgactatacggaatgctccggggccgaaagca
gaaaataacgtcaacatgtggctaacaacacccgatccggcgaatcgcctaacccaacaa
accccgatccgttgggataaggataacagtaaagaaaatgctgcgaatgcggatacactg
acgattgagattaagccagatatccattatcagacgatagagggatttggcgcagcggtg
tccggttcgtctgcatacctgatgaatcatggcttgtctgccaatcagcgtgatcggctg
ctaaatgatttgtttacagccagtggcattcaactgagttatattcgccataccattgga
gcctcagattattccgtagatgaacagggacagcctggcagctatacctatgacgatgtg
gcaacaggcaaggactatgagctgaatcatttctccatcgccaaggatcgggatgtgatc
gatgtgctgaagcaaatcttgagaagaaaccaggatttaaaaattatgggaaccccatgg
acagctccgccctggatgaaatatggggagcagatttataacggctggtatttggactat
accgattcgcgcgtctaccaggcgtatgctgactattttgttcgttacctacaggcttat
gcgaacgaagggattccgattcaggcgatttccattcaaaatgagccagaattcacgacg
tccaagtatcccagcatgagcatgggagcagcagaacaggcgaattttattaaacaatat
ctgggcccgaccctaaatcgaaaccatttatctactcacattattgcctttgaccataac
tgggatacagggagcgaatatgccaagaccgtgttaggaaatgaacaggctcgaagctat
acgcacggaacggcctttcattgctacaaaggagagcccacagcgatgacagatgtgcat
catgctttccctgataagcctgtatatatgacagaatgtagtgggggagcgtggagtctg
ggcttcggagatgatttgagctgggacatgtccaagctgatcattggtgcaccccgaaac
tggtcgcaaaatgtcctcttttggaatatcgcacttgacccgtccgggggtccgaccaat
ggggggtgcgacaactgtagaggtgtagtgaccatcgacccgttaagcggtgcagttacg
aaaaatgtggagtactatgcgattgggcacgccagcaaatttgtccgtccaggtgcggta
cgtattgattctacacattatagtggaagtatcgaaacggtcgcttatcgcaaccccgac
ggtacgcttgtcctgattgccgccaatacgggagagaacacaaagacatttaaggttcgg
cagggaaataaggttttcaaatctacccttccatccaagtccgcagctacctttcaatgg
aatcctacggtttcctga

DBGET integrated database retrieval system