KEGG   Paenibacillus polymyxa E681: PPE_01123Help
Entry
PPE_01123         CDS       T01319                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PPE_01123
   00052 Galactose metabolism
    PPE_01123
   00500 Starch and sucrose metabolism
    PPE_01123
   00520 Amino sugar and nucleotide sugar metabolism
    PPE_01123
Enzymes [BR:ppy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PPE_01123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1219740..1220633
Genome map
AA seq 297 aa AA seqDB search
MTKRVKKAIIPAAGLGTRFLPATKAMPKEMLPIINKPTIQYIVEEAIASGIEDIIIVTGK
GKRAIEDHFDNAFELESKLLEDGKLKLLEEVQRSSGVEIHYIRQKEPKGLGHAVWCARRF
IGDEPFGVLLGDDIVTGQKPCLRQLMDQYEETQNSVIGVQRVPQEFTNRYGIIEPDQQDG
RLYRVNNFIEKPAPGTAPSDLAIMGRYVFSPKIFKYLDLQEKGAGGEIQLTDAIQKLNQS
ERVYAYDFEGTRYDVGERLGYILTTLEFALASDDLKYPVMEAMNEWLKKTEKATTAG
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaagagtgaaaaaggccattattccagcagcagggttaggtacgcgcttcctc
cctgccacaaaagcgatgcctaaggaaatgcttccaattatcaataagcctacgattcaa
tatatcgtggaagaagcgattgcttctggtattgaggacatcattatcgttacgggtaaa
ggcaaacgtgccattgaggatcactttgacaacgcatttgagctggaatccaaactgctc
gaggacggtaagctgaagcttctggaggaggtacagcgttcttcgggagtggaaattcac
tacattcgccaaaaagaacccaaaggtcttggacatgcggtatggtgcgcaagacgcttt
atcggggacgagccgtttggtgtgctgctgggcgatgatatcgtaacaggtcagaaacct
tgcctgcgccagctgatggatcagtatgaggaaactcaaaattcggttatcggtgtgcag
cgggtaccgcaggaatttacgaaccgatacggcatcattgaaccggatcagcaggacgga
cgcttgtaccgagtgaataattttatagaaaaaccggctccaggcacagcaccatccgat
ttggctattatgggtcgctacgtgttctcgccgaaaattttcaaatatcttgatcttcag
gaaaaaggagctggcggcgaaattcagttgacggatgcgatccaaaagctgaatcagagt
gagcgtgtgtacgcctatgattttgaaggcacacgttatgacgtaggtgagcgtcttgga
tatattttaaccacacttgaatttgcacttgccagcgatgatttgaagtatccggttatg
gaggccatgaatgaatggttgaaaaagaccgagaaagcaaccacggcaggttga

DBGET integrated database retrieval system