KEGG   Paenibacillus polymyxa E681: PPE_01163Help
Entry
PPE_01163         CDS       T01319                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ppy00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1263887..1265812
Genome map
AA seq 641 aa AA seqDB search
MSAIAGIYSFGHESVSTEEGGKMMQALRKYPADRVCAWCEGSIFLGCHAQHVTPESVHER
LPFYDELRDLAITADAIIDNRSELFERLGVEQERRQDITDSELILLAYDKWGVEAASYLI
GDFAFVIWDAKEHRLYGARDMTGNRTLYIYQHDRGFAFSTVVAPLLALSSLRKELYEPWL
AEFLSIRAMQESVDIGTTAYKHINQLPPAHWFTMEEGKRTLHKYACLDEVEPLRLKTGGE
YIEAFREVFTQAVTARLRTHRAVGAALSGGLDSGAVASFAAPSLHLQQKPLHAYSYVPVQ
DFTDWTPPTLLANERSYIQSTARYVGNIHENYMDFEGKSPFSEIDIWLELMEAPYKYFEN
SFWIRGFYEKAQEHNVGVLLTGARGNFTVSWGPALDYYARQFRRLHWLQSFQGLWRYSKL
TGRRMSHLLPVMLKKATSLESRSWLQRSNRSPVPSLIHPEFAKRMHVEDIPVLSGTGWMK
NADQTRKEKFSNLAIANKNGVVATKLSLRYGLWERDPTGDSRVIRFCLSVPFEQYVQNGR
DRALIRTAMRDHLPDDVRLNQRVRGVQPADWLHRMLPCWDTFMGELQLMCHDLRAAEYLN
IEFIKTAMAKLHHPRPEQASDPNIRLLMHSLIVYRFLCRLN
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgcgattgccggaatctatagctttgggcatgagtccgtaagcaccgaagaaggc
gggaaaatgatgcaagccctgcgaaaatatcccgctgaccgcgtatgcgcttggtgcgaa
ggctcaatttttttgggttgtcatgcccagcatgtgaccccggaatctgttcatgagcgt
cttcccttctatgatgagctaagagatttggcaatcacggcggatgcgattattgacaat
cgttccgagctgtttgaacggctgggagttgagcaggaacggcggcaagatatcacggac
agcgagttgattttgttggcatatgacaaatggggagtggaagcagccagttatctgata
ggtgattttgcctttgtcatttgggatgccaaggaacatcgattatatggtgctcgagat
atgacaggaaatcgtacgctgtacatctaccaacatgaccgaggattcgcgtttagcacg
gtagttgctccacttttggccctgtcctctctgcgaaaagaactgtatgaaccgtggctg
gccgaatttttgtccatccgtgccatgcaggaatccgtcgatatcggaacgaccgcatac
aagcatatcaaccagcttcctcctgcacattggttcactatggaggagggaaagcgaact
cttcataaatatgcatgtctggatgaggtagagccactgcggctcaaaacagggggcgag
tacatagaagctttccgcgaggtgttcacacaggcggtcactgcccgattacggacgcat
cgcgctgtaggggctgccttgagcggagggctggattccggggcggttgccagctttgcc
gcgccatctctgcacttgcaacaaaagccgctgcatgcctacagctatgtgcctgttcaa
gattttacagactggacaccgcctacattgctggcgaacgaacgaagctatattcagtct
acggctcgctatgtgggcaacattcacgagaattatatggattttgagggtaaaagtccg
ttttctgaaattgatatttggctggaactcatggaagcaccctacaaatattttgaaaac
tccttctggatcagaggtttttatgaaaaagcacaggagcacaatgtcggtgtactattg
accggggcacgaggcaattttaccgtatcgtggggccctgcactagactattatgcccgg
cagtttcgtcgtttgcactggttgcaatcctttcagggattgtggcggtacagcaagctt
acgggcaggcgtatgtctcatctactccctgtgatgttgaaaaaagcgacttcgcttgaa
tctcgttcatggctgcagcgtagcaatcgaagtcccgttccttcactgattcacccggag
tttgccaaacggatgcatgtagaagatattcctgttttgagcggaacaggctggatgaaa
aacgccgatcagacgagaaaagagaaattttcgaatttggcgattgctaacaaaaatggt
gtggtcgcgaccaaactttcactacggtatggcctgtgggaacgtgatccgaccggagac
agccgagtgattcgcttttgcttatcggtgccttttgaacagtatgtgcaaaatggtcgg
gaccgtgccctcattcgtacggccatgcgtgatcatctacctgatgatgttcggttgaac
cagcgggtacggggtgtacagcctgcagattggttacatcgaatgcttccttgctgggat
acatttatgggagagcttcaactgatgtgtcatgatttacgagccgccgaatatctcaat
attgagtttattaagacggctatggcgaaacttcaccacccccgccctgagcaggcgtct
gatccgaatatacgactactaatgcatagcctgatcgtgtaccgttttctctgtagattg
aactga

DBGET integrated database retrieval system