KEGG   Paenibacillus polymyxa E681: PPE_01311Help
Entry
PPE_01311         CDS       T01319                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PPE_01311
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    PPE_01311
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PPE_01311
Enzymes [BR:ppy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PPE_01311
Exosome [BR:ppy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PPE_01311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1412521..1413819
Genome map
AA seq 432 aa AA seqDB search
MKKSILALGAITVLSVPLLSVNIPNAFAASSNTKSTTAQVSKGLKTSSAKVDAPKNVILF
IGDGMGEASRNAIRLATVGKSGLLEMDNMPVTGLVSTSSGDNLVTDSAAAATAIATGMKT
YNGAIGMDLNKKPVTTIMELAKKAGMSTGVVTTSQVTDATGAAFGAHVEKRSAQSEIAKQ
YLEKSKLDVILGGGEDFWYPAGTVGKHLDAPAEDPEEASKGTQGNLVEQAKKLGYSYVTD
QAGMKAAKGSKLLGLFANEEMFQAHNKLGNSYNPTVSLPDMTAKAIDVLSKNQKGFFLMV
EEEGTDEMAHDNEGELTIKAGQQLDKAVKVAKEYAKAHPDTLVLVTADHETGGLAIEGED
AEDESGEGISKEDGPFTVKGSDEKFYIDWTTGGHTSVDVALTAMGPGSSQFSGNYPNTAI
HDKLVKLLQLKK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagagtatccttgctttaggtgccattaccgttttgagtgtgccattgttatct
gttaatatccctaacgcttttgcagcctcatctaataccaagtccactaccgcacaggta
tccaaaggactgaaaacttcgtcagcgaaagtcgatgctcctaaaaatgtcattctcttt
atcggcgatggtatgggagaagcaagtcgcaacgcgattcgcttggcgacggtagggaaa
tcgggattacttgaaatggacaatatgcctgtaactggcctggttagcacaagttcaggg
gataatctggttacggattctgctgctgctgcgactgccattgcaacaggtatgaaaacg
tataacggcgcgattggaatggatttgaataaaaaaccagtgacaacgattatggagctg
gccaaaaaagcaggcatgtctacaggtgtggtgacgacaagccaagtgacagacgcaacg
ggggccgcctttggtgcgcatgttgaaaaacgatccgctcaaagcgagattgccaagcag
tatctggagaaaagcaagctggatgttattctgggcggtggtgaggatttctggtatcct
gccggaacagtaggcaaacatctagatgctccggcagaagatcctgaggaagctagtaag
ggaactcaaggaaatttggtagaacaagcgaagaagctgggttatagctatgtgacggat
caggcaggaatgaaagcagccaaaggttctaagttgctagggctgttcgccaatgaagag
atgtttcaagctcacaacaagctgggtaactcttacaatccaacggtttctttaccggat
atgacggctaaagctattgatgttctttccaaaaaccaaaaaggttttttcctgatggta
gaggaagaaggaacggatgagatggcgcatgacaatgaaggtgagttaacgattaaggct
gggcaacaacttgataaagccgttaaagtagctaaagagtatgccaaagcgcatccagat
acattagtgttggtgacggcagatcatgaaacgggcggtttggcgattgaaggcgaagat
gcggaggatgaatccggtgaaggcatttccaaagaggatggtccttttactgtaaaaggc
tccgatgaaaagttttatatcgactggaccacgggaggacatacatccgttgatgtcgcg
ttaaccgcaatgggccccggctcttctcagtttagcgggaattacccgaatactgccatt
catgacaagctggttaagttgcttcaattaaagaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system