KEGG   Paenibacillus polymyxa E681: PPE_01350Help
Entry
PPE_01350         CDS       T01319                                 

Gene name
sucB
Definition
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (E2) (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PPE_01350 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PPE_01350 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    PPE_01350 (sucB)
Enzymes [BR:ppy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PPE_01350 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1451417..1452715
Genome map
AA seq 432 aa AA seqDB search
MSDIIVPAMGESITEGTISKWLVKEGDSVGQGDVLLELETDKVNLEISAEEAGVVQKILR
QEGDTVVIGEAVGLIGSGSGGGESTSAGEVAATQAPEAPSVATSPSSVGGGVKAEEKSAP
PISSNGDGNGQTASPSARKLARERGIDLEQVQGKDPLGRVFQEDVKTHNSAEVSRAASVP
ASPATSKPAPPSPAQTEYSKPVERQRMSRRRATIAKRLVEAQQTAAMLTTFNEVDMTAIL
DVRKRRKDKFKEKHDVGLGFMSFFTKAVVGALKRFPTVNAEINGDDIVLKKYYDIGIAVS
AKEGLVVPVVRDADRLGFAEIEKSIADLAGKARSNSLSLADLQGGTFTITNGGIFGSLLS
TPILNTPQVGILGMHKIQLRPIAIDEERMENRPMMYIALSYDHRIIDGSEAVRFLVTVKE
LLEDPESLLLEG
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgatattatagtgccagcaatgggagaatccatcacggaaggaacaatctccaaa
tggcttgtgaaggaaggggattccgtaggacagggagatgttctactagagctggaaacc
gataaggtcaatctggaaattagtgcagaagaagcaggtgtggtccagaaaatccttcgt
caggagggagatactgtggtcatcggtgaagctgttggcttgatcggaagcggcagtggt
ggtggggaatcaaccagtgctggagaagttgcagcgactcaagcgcctgaagcaccgtcc
gtagcgacttcaccgtcttccgtaggaggcggcgttaaagcagaagaaaagtctgcaccg
cctatttcatcgaatggcgacgggaatggccagacggcatcaccatccgcccggaagttg
gcgcgtgagcgcgggattgatcttgagcaggtacagggaaaggacccgctcggacgtgtt
ttccaggaggacgtaaaaacgcataacagcgctgaagtgtcacgtgcagcttctgtacct
gcgtctcccgctactagcaagcctgcgcctccgtctccagcacaaacggagtacagcaag
cccgtggaacgccagcggatgtctcgacgcagagcgacgatcgcgaagcgtcttgttgaa
gcacagcaaacagctgccatgctcaccacttttaatgaagtagatatgaccgccattctc
gatgtgcgtaaacgccgtaaagataaattcaaggaaaaacatgatgtaggcttgggtttt
atgtccttctttacaaaggcagtggttggtgcactcaagcgcttccctaccgtgaatgca
gaaattaatggcgatgatatcgtactgaaaaaatactatgatatcgggatcgctgtatct
gccaaggaaggtttggtcgtgccagttgtgcgggatgctgatcgtctcggctttgctgag
atcgagaagagcattgcggatttggctggcaaagctcgctccaattcgctttctctggcc
gacttgcaagggggaacttttactataaccaatggaggtattttcggttccctgctgtct
acgccaattctcaatacgccacaagtgggtattttgggaatgcataaaattcaacttcgc
ccgattgccatcgacgaggaacgtatggaaaatcgtccgatgatgtatatcgcgctgtcc
tacgatcaccggattattgatggtagtgaggcggttcgtttcctggtaacggtcaaagaa
ttgttggaagatccggaatcattgttactggaaggataa

DBGET integrated database retrieval system