KEGG   Paenibacillus polymyxa E681: PPE_01374Help
Entry
PPE_01374         CDS       T01319                                 

Gene name
leuB
Definition
3-isopropylmalate dehydrogenase (EC:1.1.1.85)
Orthology
K00052  
3-isopropylmalate dehydrogenase [EC:1.1.1.85]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Valine, leucine and isoleucine biosynthesis
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    PPE_01374 (leuB)
   01230 Biosynthesis of amino acids
    PPE_01374 (leuB)
  Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    PPE_01374 (leuB)
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    PPE_01374 (leuB)
Enzymes [BR:ppy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.85  3-isopropylmalate dehydrogenase
     PPE_01374 (leuB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1475759..1476835
Genome map
AA seq 358 aa AA seqDB search
MADVKKIAVIAGDGIGPEVVAEAEKILKRTEEVFGLSFETEHALFGGIAIDKKGTPLPEE
TLAVCQAADAVLLGAVGGPQWDNNPKELRPETGLLGIRKELGLFSNLRPAVVFDCLKDAS
TLKPEVLEGTDLIVVRELTGGIYFGEKFRRESPQGEEAVDTCAYNVTEVERIVRQSFEIA
QKRRKKLASVDKANVLETSRLWREVVNRVAVDYPDVELEHVLVDNCAMQLLRRPSSFDVI
VTENMFGDILSDEAAMLTGSIGMLSSASLGQGSFGLYEPVHGSAPDIAGQGLANPIATIL
SVALMFRLTFGYEKAADAIEKAVAEVLDAGHRTADIAVDKSQAISTTQMGDLIAAAIR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgttaaaaagattgcggtaatagcgggagatggaattggaccggaagtggtc
gcagaggcagagaaaattttgaaacgtacggaagaagtgttcggcctttcatttgaaacg
gagcatgcgctgttcggcgggattgccattgataagaagggcacaccattgccagaagaa
acactggcagtatgtcaagctgcagatgctgttctgctgggggcggtaggaggaccacaa
tgggacaacaatccaaaggaacttcgtcctgaaaccggactgttgggcattcgtaaagag
ctcggtctgttttcgaatcttcgtcctgctgtcgtctttgactgtctcaaggacgcatct
acattgaaaccggaagtgttggaaggaacggacctgatcgtggtgcgcgaactgacgggc
ggcatttatttcggcgagaagttcagacgagaaagtcctcaaggtgaggaagcagtcgat
acttgtgcatataatgtaacagaagtagagcgtatagtgcgccaatctttcgaaattgca
caaaaacgtcgcaaaaaactcgcatcggtggataaggctaatgtactggaaacctcccgt
ttatggcgtgaagtagtgaaccgggttgctgtagactacccggatgtcgagctggagcat
gtattggttgataactgcgccatgcaattgctgcgtcgtccatctagctttgacgtcatc
gtgacggaaaatatgtttggtgacattctcagtgatgaagcggctatgctgaccggatcc
atcggcatgctctcctccgcatcacttggacaaggtagcttcggcctatacgagccggta
catggctcggcgcctgacattgcaggtcaagggctggcgaatcccattgcaacgattttg
tccgttgctttaatgttccgtctcaccttcgggtacgagaaggcagctgatgccattgag
aaagcggtagctgaggtactggatgcagggcaccgtacggcggatattgcggtggataaa
tctcaagcgatctcgacaactcaaatgggcgatctgatcgcagcagctattcgttaa

DBGET integrated database retrieval system