KEGG   Paenibacillus polymyxa E681: PPE_01575Help
Entry
PPE_01575         CDS       T01319                                 

Definition
(GenBank) acetyl-CoA carboxylase carboxyl transferase subunit alpha
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
ppy00061  Fatty acid biosynthesis
ppy00620  Pyruvate metabolism
ppy00640  Propanoate metabolism
ppy01100  Metabolic pathways
ppy01110  Biosynthesis of secondary metabolites
ppy01120  Microbial metabolism in diverse environments
ppy01130  Biosynthesis of antibiotics
ppy01200  Carbon metabolism
ppy01212  Fatty acid metabolism
Module
ppy_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PPE_01575
   00640 Propanoate metabolism
    PPE_01575
  Lipid metabolism
   00061 Fatty acid biosynthesis
    PPE_01575
Enzymes [BR:ppy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     PPE_01575
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     PPE_01575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACCA Carboxyl_trans MdcE ECH_1
Motif
Other DBs
NCBI-ProteinID: ADM69414
UniProt: E0RD08
Position
1683022..1684005
Genome map
AA seq 327 aa AA seqDB search
MAGELPYEKPLVEMRQKIEELKQFGQDKQIDFTDEINRLEDRYLEMEEEIYSNITAPQKM
HLARHHQRPTSLDLIEQVFTDFIELHGDRLFGDDLAVVGGIAKLNGIPVTVIGQQRGKDT
KDNIARFFGSAHPEGFRKGLRLMQQADKFKRPIITFIDTKGAYPGNTAEERGQSEAIARN
LREMAKLSVPVICVVIGEGGSGGALAFAVGNRVLMLEHAIYSAISPNGAASILWKDASKA
DQAAEAMKITANDLLRMEIIEDIVPEPKGGAHRNYEVTAAAIKELLERHLADLTNMSCDE
LREDRYQKFRKIGQYTFLKPSESEPML
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggctggtgaattgccttatgaaaagcccctggtcgagatgcgacagaagatcgaagaa
ctcaagcaattcggacaggataagcaaattgattttacagatgaaatcaaccgtctcgag
gaccgttatctcgagatggaagaagaaatatattcaaacattacagcaccacaaaaaatg
catttggcccgtcatcatcaaagaccaacgtctcttgatctgattgagcaggtgtttacg
gactttattgaattacacggcgaccgcttgtttggagacgatctggcggttgtgggcgga
attgccaagctaaatggtattccggtgaccgtcattggtcaacagcgtggtaaggatacg
aaagataacattgcacgtttctttggtagtgctcatccggaaggatttcgtaaaggcttg
cgtcttatgcagcaggctgataaattcaaacgccctattattacattcattgatacgaag
ggcgcttatccgggtaatacagcagaggagagaggtcaatcggaagcgattgcccgcaac
ttgcgggagatggcaaagctttcggtgcctgttatttgtgtggtcatcggcgagggtgga
agcggcggtgcgcttgcgtttgcagtcggtaaccgtgtgctgatgctggaacatgccatt
tattcggccatttctccaaacggtgccgcctcgattctatggaaagatgcttccaaggcc
gatcaggcagctgaagccatgaagattacggctaatgacctcctgcgcatggaaattatc
gaggatattgtgccggagccgaaagggggcgcgcatcgtaactatgaagtgaccgctgcg
gcaatcaaggagcttttggaacgtcatttggcagaccttacgaatatgagctgcgatgaa
ttgagggaagatcggtatcaaaaattccgaaaaataggtcaatacaccttcttgaagcct
tcggaatctgagcctatgttgtaa

DBGET integrated database retrieval system