KEGG   Paenibacillus polymyxa E681: PPE_01575Help
Entry
PPE_01575         CDS       T01319                                 

Gene name
accA
Definition
acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (EC:6.4.1.2)
Orthology
K01962  
acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PPE_01575 (accA)
   01212 Fatty acid metabolism
    PPE_01575 (accA)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PPE_01575 (accA)
   00640 Propanoate metabolism
    PPE_01575 (accA)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    PPE_01575 (accA)
  Metabolism of terpenoids and polyketides
   00253 Tetracycline biosynthesis
    PPE_01575 (accA)
Enzymes [BR:ppy01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     PPE_01575 (accA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1683022..1684005
Genome map
AA seq 327 aa AA seqDB search
MAGELPYEKPLVEMRQKIEELKQFGQDKQIDFTDEINRLEDRYLEMEEEIYSNITAPQKM
HLARHHQRPTSLDLIEQVFTDFIELHGDRLFGDDLAVVGGIAKLNGIPVTVIGQQRGKDT
KDNIARFFGSAHPEGFRKGLRLMQQADKFKRPIITFIDTKGAYPGNTAEERGQSEAIARN
LREMAKLSVPVICVVIGEGGSGGALAFAVGNRVLMLEHAIYSAISPNGAASILWKDASKA
DQAAEAMKITANDLLRMEIIEDIVPEPKGGAHRNYEVTAAAIKELLERHLADLTNMSCDE
LREDRYQKFRKIGQYTFLKPSESEPML
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggctggtgaattgccttatgaaaagcccctggtcgagatgcgacagaagatcgaagaa
ctcaagcaattcggacaggataagcaaattgattttacagatgaaatcaaccgtctcgag
gaccgttatctcgagatggaagaagaaatatattcaaacattacagcaccacaaaaaatg
catttggcccgtcatcatcaaagaccaacgtctcttgatctgattgagcaggtgtttacg
gactttattgaattacacggcgaccgcttgtttggagacgatctggcggttgtgggcgga
attgccaagctaaatggtattccggtgaccgtcattggtcaacagcgtggtaaggatacg
aaagataacattgcacgtttctttggtagtgctcatccggaaggatttcgtaaaggcttg
cgtcttatgcagcaggctgataaattcaaacgccctattattacattcattgatacgaag
ggcgcttatccgggtaatacagcagaggagagaggtcaatcggaagcgattgcccgcaac
ttgcgggagatggcaaagctttcggtgcctgttatttgtgtggtcatcggcgagggtgga
agcggcggtgcgcttgcgtttgcagtcggtaaccgtgtgctgatgctggaacatgccatt
tattcggccatttctccaaacggtgccgcctcgattctatggaaagatgcttccaaggcc
gatcaggcagctgaagccatgaagattacggctaatgacctcctgcgcatggaaattatc
gaggatattgtgccggagccgaaagggggcgcgcatcgtaactatgaagtgaccgctgcg
gcaatcaaggagcttttggaacgtcatttggcagaccttacgaatatgagctgcgatgaa
ttgagggaagatcggtatcaaaaattccgaaaaataggtcaatacaccttcttgaagcct
tcggaatctgagcctatgttgtaa

DBGET integrated database retrieval system