KEGG   Paenibacillus polymyxa E681: PPE_01733Help
Entry
PPE_01733         CDS       T01319                                 

Definition
xanthine phosphoribosyltransferase (EC:2.4.2.-)
Orthology
K03816  
xanthine phosphoribosyltransferase [EC:2.4.2.22]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PPE_01733
Enzymes [BR:ppy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.22  xanthine phosphoribosyltransferase
     PPE_01733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1844092..1844664
Genome map
AA seq 190 aa AA seqDB search
MEVLKKRILNEGVIASDQVLKLDGLLNHQVDPELTMAMGREFAARFREEKITRVVTVESS
GIAIGFATALELGVPLVFARRKKTLLADPDALCERVPSFTKGIVTDIMLSRQFIHEDDRV
LFIDDIIANGDAARGMVKIIQRSGAELVGFGVAVEKSFQAGARTIREQGIRVESLVKISS
LADGKIEFAE
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggaagtattaaagaaacgaattttaaatgaaggcgtgattgcatcagatcaggtgctg
aagctggatggtttgcttaatcaccaggttgatccagagctgacaatggcaatgggacga
gagttcgcagcacgtttcagggaagagaagattaccagagtagtaaccgtggagtcctca
ggcattgccatcgggtttgcgacagcattggaattgggtgtaccgttggtattcgctcgt
cgtaaaaagaccctattagctgatccagacgcgctatgtgaacgcgtaccttcgtttact
aaaggtattgttacggatattatgctgtctcgtcaatttattcacgaagatgaccgtgtt
ctgttcattgatgatattatcgctaatggtgatgcggcgcgaggcatggttaaaatcatt
caacgctctggagcggagttggttggatttggtgtcgcggtggaaaaaagctttcaggcc
ggagcgagaaccatccgtgagcagggtattcgtgtagagtcattggtcaaaatttcgtcg
ttagctgacggcaagattgagtttgctgaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system