KEGG   Paenibacillus polymyxa E681: PPE_01833Help
Entry
PPE_01833         CDS       T01319                                 

Definition
beta-galactosidase I (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ppy00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1951660..1953687)
Genome map
AA seq 675 aa AA seqDB search
MISSKLPKVFYGGDYNPEQWDEATHQEDLRMFRQAGIDIATVNVFSWAKIQSDEITYHFE
WLDQLIDSLYESDIFVCLATSTAAHPAWMATRYPDILRVDADGRKRKFGGRHNSCPNSPT
YRKYAEQMAERIAERYKNHPAILVWHVSNEYGGDCYCDNCAAAFRVWLKQKYGSLEELNR
VWNTSFWGHTFYDWDEIVPPNNLSEHWGENHSTFQGISLDYARFNSDSMLDCYLLEYNAI
KKHVPDAVVTTNLMGFFKQLDYFKWAKHMDIVSWDSYPAANTPPSYTAMAHDLMRGLKDG
QPFMLMEQTPSQQNWQAYNSLKRPGVMRLWSYQAVAHGADTVMFFQLRRSIGACEKFHGA
VIEHAGHENTRVFREVAQLGTELGALGNTLLDATVHAKVAILFDWDNWWALEKSSGPSVA
LKYMDQVHKYYAPLFRRNVQVDLISVDANFQKYDLIIAPVLYMVKPGTAEKLEQFTEHGG
TFVTTFFSGIVNENDLVTTGGYPGKLRNLLGIWVEEIDALLPESHNRIVLKEKMGVLQGE
YKCGLLCDLLHSEGAEVLAEYGEDFYQGMPVLTRNRFGQGEAWYVASDPEETFLDGLLGY
ICEQKGIPSLLRAPAGVEATIRTKDGKSYLFVLNHNAQTQQYHLDDQKGNELVSGKYLEG
DISIEGYGFQVLELS
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgataagcagcaaacttcctaaagtattttacggtggagattataatcctgagcaatgg
gatgaggccacgcatcaggaagatttacggatgttcaggcaagcagggattgatatcgcc
acggtcaacgtattctcatgggccaaaattcagtccgacgaaatcacatatcattttgaa
tggctggatcaattgattgacagtctttatgaaagcgatatcttcgtttgtttagctact
agcacggcagcgcatccagcttggatggctacgcgttatcccgacattctgcgggtcgat
gctgacgggcgtaagcggaaattcggtggacgccacaactcctgtccgaacagtccaacg
tatcgaaaatatgcggagcagatggctgaacgaattgcagaacgatacaaaaaccatccc
gcgatcctcgtatggcacgtgtccaatgaatacggcggagattgctattgtgataactgc
gcagccgcattccgggtgtggctcaagcaaaaatacggatcattggaagagctaaaccgg
gtgtggaatacttccttctggggtcacaccttctatgattgggatgaaattgtaccgcca
aataatctgagcgagcattggggagaaaatcactcaacctttcagggcatatccctcgat
tatgcgcgcttcaattcagacagtatgctggattgctacctactggaatataacgcgatt
aaaaaacatgttcccgatgccgtggtaacgaccaatctgatgggctttttcaaacaattg
gactattttaaatgggctaagcacatggatattgtatcttgggatagttatcctgcggcc
aataccccgccgagctatacggcgatggcgcacgatctgatgcgcggcttgaaggatggg
caaccctttatgctgatggagcaaacaccgagccagcagaactggcaggcgtataattcg
cttaaacggcctggcgttatgcggttatggagttatcaggcagtcgcgcatggcgcggac
acggtcatgttcttccagcttcgccgctcgatcggcgcttgtgagaaattccacggggcc
gtcatcgagcatgccgggcatgagaacacacgtgtatttcgcgaggtggcacagcttggc
actgagcttggcgcattaggcaacacgctacttgacgcgaccgttcatgccaaagtagcc
attttattcgattgggataattggtgggctttggaaaaatcaagcggcccttctgtcgcc
ttgaaatatatggatcaggtacacaagtattatgctcccctcttccggcggaatgtacag
gtagacctgatttctgttgatgcaaatttccagaaatatgatctcattatcgcgcctgta
ctctacatggtcaagccgggtactgccgagaagctggaacaattcacagagcatggcggc
accttcgtaacgacctttttcagcggcattgtaaatgaaaacgatctggtcacaaccgga
ggatatcctggtaaactacgtaacttgcttgggatctgggtggaagaaattgacgcgctt
ctgccggaatcacacaatcgcattgtattgaaagaaaagatgggcgtattacaaggtgaa
tataaatgcggtctgctctgcgacttgttgcatagcgaaggcgcggaggtgctggccgaa
tacggcgaagatttctatcagggcatgccagtgctgacacgcaatcgtttcggtcaaggt
gaggcatggtacgttgcttcagatcctgaagagactttccttgatggcctgctgggctac
atttgtgagcaaaaagggattccatctctgctgcgtgctcctgcgggtgtagaagccact
atacggaccaaagatggaaaatcatatctattcgttctgaatcataacgcccagacgcag
caatatcatctggatgatcagaaagggaatgagctggtcagtggtaaatacctggaagga
gatatttctattgaaggctacggctttcaagtactggagctatcataa

DBGET integrated database retrieval system