KEGG   Paenibacillus polymyxa E681: PPE_01873Help
Entry
PPE_01873         CDS       T01319                                 

Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ppy01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ppy00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ppy00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:ppy00660]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1992886..1994046
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQGKEVLKQYGVAVPNGKVAYTVEEAVAAAESLGSAITVVKAQIHAGGRGKAGGV
KVAKGLDEVRTFASEILGKVLVTHQTGPEGKEVKRLLVEEGCDIRKEYYVGVVVDRATGR
IVMMASEEGGTEIEEVAAATPEKIFKAVVDPAIGLQVYQARKLAYDINIPNELVNKAVKF
MLALYEAFVDKDCSIAEINPLVVTGDGNVLALDAKLNFDSNALFRHKDILELRDLDEEDE
KEIEASKYDLSYIALDGNIGCMVNGAGLAMATMDIIKYYGGDPANFLDVGGGATTEKVTE
AFKIILSDPKVEGIFVNIFGGIMQCDIIAYGVVEAAKQLGLTRPLVVRLEGTNVELGKQI
LAESGLNIVAADSMADGAQKIVELVQ
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgaatatcagggtaaagaagtattaaagcagtacggagtggctgtaccg
aacggtaaggttgcctatacggtggaagaagccgttgcggcggcagaatcgcttggaagc
gctattacggtcgtaaaagcacaaattcatgcgggtggacgtggtaaagcgggtggcgta
aaagtggccaaaggtttggatgaggtgcggacttttgcttctgaaattttgggtaaggta
ctagtcacacatcagaccggacctgaaggtaaagaggtcaaacgccttttggttgaggaa
ggttgcgatattcgtaaagaatattacgtcggcgttgtcgtagatcgtgcgactggacgt
atcgtaatgatggcctcagaagaaggcggtacggaaatcgaagaggtggctgcagccact
ccggagaaaatttttaaagcggttgttgatccagcgattgggcttcaggtgtatcaggcg
cgtaagttggcgtatgacattaatattcctaatgaactggtaaacaaagcggttaagttt
atgctggcgctatacgaagcttttgtggacaaggattgttcgattgcagaaatcaatccc
ttagtcgttacgggtgatgggaatgtactggcgttagatgccaaacttaatttcgattct
aatgcgttgttccgtcacaaggatattttggaattgcgtgatttggatgaagaggatgag
aaggaaattgaggcatctaaatacgatctaagctatatcgctctggacggaaatattggc
tgtatggtcaatggtgcgggtttggcgatggcaaccatggatattattaaatattacggt
ggcgatccggccaacttcctggacgtagggggcggtgcgacgacggaaaaggtaaccgaa
gcgttcaaaatcattttgtccgatccgaaggtagaaggtattttcgtgaacattttcggc
ggaattatgcagtgtgacatcattgcgtacggcgtcgtggaggctgccaaacagttgggg
cttactcgtccgcttgttgtccgtcttgaagggacaaatgttgagctcggcaaacagatt
ttagcggaatccggtttgaatatcgtagcagccgattccatggcggatggcgcccaaaaa
atcgtcgaacttgttcaatag

DBGET integrated database retrieval system