KEGG   Paenibacillus polymyxa E681: PPE_01873Help
Entry
PPE_01873         CDS       T01319                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PPE_01873
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PPE_01873
   00640 Propanoate metabolism
    PPE_01873
   00660 C5-Branched dibasic acid metabolism
    PPE_01873
Enzymes [BR:ppy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PPE_01873
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1992886..1994046
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQGKEVLKQYGVAVPNGKVAYTVEEAVAAAESLGSAITVVKAQIHAGGRGKAGGV
KVAKGLDEVRTFASEILGKVLVTHQTGPEGKEVKRLLVEEGCDIRKEYYVGVVVDRATGR
IVMMASEEGGTEIEEVAAATPEKIFKAVVDPAIGLQVYQARKLAYDINIPNELVNKAVKF
MLALYEAFVDKDCSIAEINPLVVTGDGNVLALDAKLNFDSNALFRHKDILELRDLDEEDE
KEIEASKYDLSYIALDGNIGCMVNGAGLAMATMDIIKYYGGDPANFLDVGGGATTEKVTE
AFKIILSDPKVEGIFVNIFGGIMQCDIIAYGVVEAAKQLGLTRPLVVRLEGTNVELGKQI
LAESGLNIVAADSMADGAQKIVELVQ
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgaatatcagggtaaagaagtattaaagcagtacggagtggctgtaccg
aacggtaaggttgcctatacggtggaagaagccgttgcggcggcagaatcgcttggaagc
gctattacggtcgtaaaagcacaaattcatgcgggtggacgtggtaaagcgggtggcgta
aaagtggccaaaggtttggatgaggtgcggacttttgcttctgaaattttgggtaaggta
ctagtcacacatcagaccggacctgaaggtaaagaggtcaaacgccttttggttgaggaa
ggttgcgatattcgtaaagaatattacgtcggcgttgtcgtagatcgtgcgactggacgt
atcgtaatgatggcctcagaagaaggcggtacggaaatcgaagaggtggctgcagccact
ccggagaaaatttttaaagcggttgttgatccagcgattgggcttcaggtgtatcaggcg
cgtaagttggcgtatgacattaatattcctaatgaactggtaaacaaagcggttaagttt
atgctggcgctatacgaagcttttgtggacaaggattgttcgattgcagaaatcaatccc
ttagtcgttacgggtgatgggaatgtactggcgttagatgccaaacttaatttcgattct
aatgcgttgttccgtcacaaggatattttggaattgcgtgatttggatgaagaggatgag
aaggaaattgaggcatctaaatacgatctaagctatatcgctctggacggaaatattggc
tgtatggtcaatggtgcgggtttggcgatggcaaccatggatattattaaatattacggt
ggcgatccggccaacttcctggacgtagggggcggtgcgacgacggaaaaggtaaccgaa
gcgttcaaaatcattttgtccgatccgaaggtagaaggtattttcgtgaacattttcggc
ggaattatgcagtgtgacatcattgcgtacggcgtcgtggaggctgccaaacagttgggg
cttactcgtccgcttgttgtccgtcttgaagggacaaatgttgagctcggcaaacagatt
ttagcggaatccggtttgaatatcgtagcagccgattccatggcggatggcgcccaaaaa
atcgtcgaacttgttcaatag

DBGET integrated database retrieval system