KEGG   Paenibacillus polymyxa E681: PPE_01906Help
Entry
PPE_01906         CDS       T01319                                 

Definition
chemotaxis protein CheY (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:ppy02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:ppy02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2024862..2026385
Genome map
AA seq 507 aa AA seqDB search
MCAYRVLVVDDSAFMRKIITDLIVRDESFNIVGTAANGKEAVEKVKELQPDLVTMDVEMP
EMNGLEALPLIMAAHPLPVIMLSGINEQGMKETIMALEAGAFDFIRKPSIAHAQDIEQVS
KALLEQMHTAMQAVRSRLERKEANERKAALEQAKKTPQEKPPGQAVTEKRAGSQASTDKP
PVVPIAPSPAVSAQPKRDAGKSVPAAAKQETKRQQSGTSVTAGRIEQPAAQPSKSVQAPT
VQKKEDLSKGMGRTPGQLNSSNTATGKSLHGKDKTGLVKPEPRKTVISSATPPVTAPTVP
ATPKGFSLKKGVHTSSFRKLVAVGCSTGGPRALKTLLERIPGDFPAPIVIVQHMPPNFTR
SLAQRLNTLSPLRVVEAEQGMTLETGTAYIAPGGYQLRIVPGAGGKYTVSLKMEEARNGH
RPSVDTMFESLLSLTSLERHLVLLTGMGSDGAKMMKKLYDAGVQSTFAENEETCVVYGMP
RSAVELKCVRHLLPMQEIAPKLVQVVK
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgcttaccgggtgctggttgtagatgattcggcctttatgcgcaaaattattaca
gatttaattgtaagggatgagtcgttcaacatcgtaggtacagccgccaatggcaaagag
gctgtagagaaagtgaaggaattgcagcccgatttggtcaccatggatgtcgagatgcct
gaaatgaatggtcttgaagcattgccattgattatggcagcccatccgctacctgttatt
atgctgtcaggcattaatgaacaaggtatgaaggagaccatcatggcgctggaggcagga
gctttcgattttataagaaagccttccattgctcatgcgcaagatatcgagcaagtgagc
aaggcgctgctggaacagatgcacactgctatgcaagcagtgcggagccgcctggagcgc
aaggaagctaatgagcgcaaagctgcattggaacaagcgaaaaaaacgccacaggaaaag
cctccagggcaggctgtgactgagaaacgagcaggcagtcaagcttcgacagacaagcct
cctgttgttccgattgctccttcacctgctgtatcagctcagccgaagcgtgatgctggc
aagtccgtcccggcagcagccaagcaggaaactaaacgacaacagtctggaacatctgtt
acggcggggcgcatagaacagccggctgctcagccaagcaagtcagtccaagcacctact
gttcagaagaaggaagacttgtccaaggggatgggacgaacaccagggcaactaaacagt
tctaatacggccactggcaaatcgctgcatggtaaggataaaacagggctggttaagccg
gagccccgtaagacggtgatttcatcagctacgcctccagtaacggcacctacagttcct
gccacacctaagggattttctcttaaaaaaggtgtgcatacgtccagctttcgcaaactg
gtggcggtgggatgttctacgggtggcccgcgggcgcttaagacgctgttggaacgcatt
cctggtgattttcctgctccaatcgttatcgttcagcatatgccgccaaacttcactcgt
tcgctggcacaacgcttaaacacgttaagtccactccgagttgtggaggctgagcaggga
atgacgctggagactggaacggcctacattgccccagggggatatcaactaagaattgtg
ccaggagccggtggtaaatacactgtgtcactgaagatggaggaagctcgcaatggtcac
cgtccttccgtagatacgatgtttgaatcgttgctctcgttaacctcgttggagcggcat
ctagtattgctcactggaatggggagcgacggggccaaaatgatgaaaaagctttatgat
gctggggtacaatccacatttgctgaaaatgaggaaacttgtgtagtgtacggaatgccc
cgctcagcagtagagttaaaatgtgtgcgtcaccttctgccaatgcaggagatcgccccc
aagcttgtacaagttgtgaaataa

DBGET integrated database retrieval system