KEGG   Paenibacillus polymyxa E681: PPE_02368Help
Entry
PPE_02368         CDS       T01319                                 

Definition
(GenBank) hypothetical protein
  KO
K01476  arginase [EC:3.5.3.1]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
ppy00220  Arginine biosynthesis
ppy00330  Arginine and proline metabolism
ppy01100  Metabolic pathways
ppy01110  Biosynthesis of secondary metabolites
ppy01130  Biosynthesis of antibiotics
ppy01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    PPE_02368
   00330 Arginine and proline metabolism
    PPE_02368
Enzymes [BR:ppy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     PPE_02368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADM70198
UniProt: E0RLJ8
Position
2616122..2616439
Genome map
AA seq 105 aa AA seqDB search
MTKKTIGNLLGEGDEEFAKHVKIPLKPENVFIAGLAAPTEQETEVISEAFQRLDIAPVES
DTEVIQRLGIKTAGTIELTNSTESIREWIKESGIKHLAIHREYPL
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaaaacaatcggaaatcttttgggagaaggagatgaggagttcgcaaaacat
gtgaaaatcccactaaaacctgaaaatgtctttatcgcgggtttagcggctcctacagaa
caagaaacagaagtcatttcagaagcgtttcaaagactagatatagctcctgtagaatca
gacacagaagtgattcaaagactaggaattaaaactgcaggaaccatagagttaacgaat
agtactgaatctataagagagtggattaaagaaagtggcattaagcacctagctattcac
cgcgaatatcccctataa

DBGET integrated database retrieval system