KEGG   Paenibacillus polymyxa E681: PPE_02368Help
Entry
PPE_02368         CDS       T01319                                 

Definition
hypothetical protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PPE_02368
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PPE_02368
Enzymes [BR:ppy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     PPE_02368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2616122..2616439
Genome map
AA seq 105 aa AA seqDB search
MTKKTIGNLLGEGDEEFAKHVKIPLKPENVFIAGLAAPTEQETEVISEAFQRLDIAPVES
DTEVIQRLGIKTAGTIELTNSTESIREWIKESGIKHLAIHREYPL
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaaaacaatcggaaatcttttgggagaaggagatgaggagttcgcaaaacat
gtgaaaatcccactaaaacctgaaaatgtctttatcgcgggtttagcggctcctacagaa
caagaaacagaagtcatttcagaagcgtttcaaagactagatatagctcctgtagaatca
gacacagaagtgattcaaagactaggaattaaaactgcaggaaccatagagttaacgaat
agtactgaatctataagagagtggattaaagaaagtggcattaagcacctagctattcac
cgcgaatatcccctataa

DBGET integrated database retrieval system