KEGG   Paenibacillus polymyxa E681: PPE_02487Help
Entry
PPE_02487         CDS       T01319                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PPE_02487
Enzymes [BR:ppy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PPE_02487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2742343..2743224)
Genome map
AA seq 293 aa AA seqDB search
MMAKISIIGSSSMDLVVTSSKRPGAGETVLGESFTTVPGGKGANQAVAAARLGADVTMIG
RVGDDHFGEQILRNFEENHVYTGYVKPVTHMESGTAHIVLAEGDNSIVVVKAANNEVTPA
YVEEALDVIRSSDIVLIQQEIPSETVVYVSEICAKYQVPLLLNPAPAREVDDSVIANATY
ITPNEHEAAIMFKDMSLQEALRKHPNKLFVTEGSNGVRFFDGEQEVLVPTYKVEAVDTTG
AGDTFNAAFAVALAEGNSLADSVKFANRAASLSVTKFGAQGGMPTRREVEEQL
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgatggctaaaatttcgattatcggaagcagttctatggatctcgtagttacttcgtcc
aaacgtcccggtgctggtgaaacggtattgggtgaaagctttacaaccgtacctggaggt
aaaggagccaatcaggcagtagccgcagcacgactcggagcggacgttacgatgattgga
cgtgtaggggatgaccattttggagaacagattttacgtaattttgaagaaaatcatgta
tatactggctatgtgaaaccggttacacatatggaaagcggtacagcgcatattgtacta
gctgaaggtgataacagtattgtcgtggtaaaagcagcaaataatgaagtgacacctgcc
tatgtggaagaagcgcttgacgtcattcgaagttcggatattgtgttaattcaacaggaa
ataccgtcggaaacagttgtttatgtaagcgaaatttgtgcgaagtaccaggtaccattg
ttgctgaatccagctccagctcgcgaggtggatgacagcgtaattgcgaatgcgacctac
attacgcctaatgagcatgaagctgccattatgtttaaggatatgagccttcaagaggcg
ctgcgcaaacatcccaacaagctgtttgtgactgagggcagcaacggtgtacggttcttc
gacggagaacaggaagtcttggttcctacttataaagtagaagccgttgatacaacaggt
gcaggagatacgtttaacgctgcttttgcagtggcattggctgaaggaaattcgctggca
gacagtgtgaaatttgctaatcgtgctgcgtcactgtccgttaccaaatttggagcccaa
ggtggaatgccaacccgtcgtgaagtggaggagcaattataa

DBGET integrated database retrieval system