KEGG   Paenibacillus polymyxa E681: PPE_02530Help
Entry
PPE_02530         CDS       T01319                                 

Definition
dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex (E2) (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PPE_02530
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPE_02530
   00020 Citrate cycle (TCA cycle)
    PPE_02530
   00620 Pyruvate metabolism
    PPE_02530
Enzymes [BR:ppy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PPE_02530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2790492..2792105)
Genome map
AA seq 537 aa AA seqDB search
MAKFEYKFPELGEGLHEGEIIKMHIKPGDKVTDEDIIMEVQNDKAVVEVPCPVNGTVQEV
FAKDGDIFNVGQVVAVIDAEGELPEQEDAPEAPAASPEPSAAAQGGAAGAARFEYKFPEL
GEGLHEGEIIKMHIKPGDKVTDEDIIMEVQNDKAVVEVPCPVNGTVQEVFAKDGDIFNVG
QVVAVIAAEGELPEQEEAPAAAKQEQDAAQGGANTKPAATPAASNKDVLATPSVRKFARE
QGVNIAQVNGSGKNGKITKEDVEAFKNGGGQAAAPVAKEAAKAQEPAKKEAKAAASSAPA
ADPRAEEERVPFKGIRKAISNAMVKSAYTAPHVTIMDEVDVTELVAFRTRIKPIAEKKGT
KVTYLPFIVKALVAASRQFPALNATIDEEANEIVYKKYYNIGIATDTDNGLIVPVIKDAD
RKSIWMIADSIRDLAVRGRDGKLAANEMRGSTISITNIGSAGGMFFTPIINFPEVAILGT
GRISEKAVVKNGEIVAAPVMALSLSFDHRIIDGATAQNFMNYIKQLLANPELLVMEV
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
gtggctaaatttgaatataaattcccggagctaggtgaaggtcttcacgaaggcgaaatc
atcaagatgcacatcaagcccggtgacaaagtaacagatgaagatatcatcatggaagta
caaaacgataaggcagtagttgaagttccttgtccggttaatggtacagtacaagaagta
tttgccaaagacggcgacatctttaacgttggtcaagtcgtagctgtaattgatgcagaa
ggtgaacttcctgaacaagaagatgcaccagaagcaccagctgctagccctgaaccaagt
gctgctgcacaaggcggagctgcaggtgcagctagatttgaatataaattcccagagctg
ggtgaaggtcttcacgaaggcgaaatcatcaagatgcacatcaagcccggtgacaaagta
acagatgaagatatcatcatggaagtacaaaacgataaggcagtagttgaagttccttgt
ccggtcaatggtacagtacaagaggtatttgccaaagacggcgacatctttaatgtaggt
caagtcgtagctgtaatcgctgcagagggtgaacttcctgagcaagaagaagcaccagct
gctgctaaacaagaacaggatgctgcacaaggcggagctaacactaaaccagctgcaact
cctgctgcttctaacaaagacgtgctggctacacctagcgtccgcaaatttgcacgtgag
caaggtgtgaacattgctcaggtgaatggctccggcaaaaatggtaaaatcaccaaagaa
gatgtagaagctttcaaaaatggtggaggtcaagcggctgcaccagtggcgaaagaagct
gcaaaagcacaagagcctgctaagaaagaagcgaaagctgcagcatcatccgcaccagca
gctgatccacgtgctgaggaagagcgcgtaccatttaaaggtatccgcaaggctatttcc
aatgctatggttaaatcggcttatacggctccgcacgttacgattatggatgaagtagat
gtaactgaactggttgctttccgtactcgtatcaaaccaattgctgagaagaaaggcaca
aaagtaacatacctgccattcatcgtaaaagctttggttgctgcttcccgtcaattcccg
gctctgaatgccacaatcgatgaagaagcaaacgaaattgtctacaaaaaatactacaac
atcggtatcgctacagatacagacaacggcttgatcgttcctgttatcaaagatgctgat
cgtaagagtatctggatgattgctgattccattcgtgatctggctgtgcgcggtcgtgat
ggaaaattggctgcgaatgagatgagagggagcacaatctccatcactaacatcggttcc
gcaggcggtatgttctttactccaatcattaacttccctgaagttgcgattttgggtact
ggccgcatcagtgaaaaagcagtcgtgaaaaacggtgaaattgtagctgctccagtaatg
gctctttccttgagctttgaccaccgtattattgacggtgcaactgctcaaaacttcatg
aactatatcaaacagctgctcgctaaccctgagttgcttgttatggaggtgtaa

DBGET integrated database retrieval system