KEGG   Paenibacillus polymyxa E681: PPE_02563Help
Entry
PPE_02563         CDS       T01319                                 

Definition
(GenBank) acireductone dioxygenase
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
ppy00270  Cysteine and methionine metabolism
ppy01100  Metabolic pathways
Module
ppy_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PPE_02563
Enzymes [BR:ppy01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     PPE_02563
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     PPE_02563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ARD Cupin_2 Cupin_1 AraC_binding
Motif
Other DBs
NCBI-ProteinID: ADM70391
UniProt: E0RAT2
Position
2825230..2825772
Genome map
AA seq 180 aa AA seqDB search
MAEILIRNTNERISGEEQVREFLESHEILYEHWDASKLSGELQENFTLTDDQKAAVLKTF
EPEIKDLAARRGYKIWDVITLSEATPNLDELLAKFEQIHTHTEDEIRAIVAGKGIFIIKG
PEEIGYFNVELSPGDVISVPENIPHFFTLMENQKIVAIRLFIEENGWIAEPYEDPTFIKA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaatcttaatacgtaatacgaatgaacgaattagcggtgaagaacaagtacgt
gaatttctggagagtcacgagatattgtatgaacattgggatgcttccaaattgtctggg
gagctgcaagaaaactttaccttaacagatgatcaaaaggccgctgttctcaaaacattt
gaacccgaaatcaaggatttagccgcacgtcgcggatataaaatatgggacgttatcact
ttatctgaagcaacgccgaatttggacgagctgctggccaagtttgagcaaattcacacc
cacaccgaggatgaaattcgtgccattgtcgctggtaaaggcattttcattattaaaggc
cctgaagagatcggctattttaacgtagagctttcaccgggggacgttatctccgtacct
gaaaatatacctcacttcttcactttaatggagaatcaaaagatcgtcgcaatccgcttg
ttcatcgaagaaaatggctggattgccgaaccgtatgaagatccaaccttcattaaagca
tga

DBGET integrated database retrieval system