KEGG   Paenibacillus polymyxa E681: PPE_02686Help
Entry
PPE_02686         CDS       T01319                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PPE_02686
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PPE_02686
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    PPE_02686
Enzymes [BR:ppy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     PPE_02686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2952659..2953864
Genome map
AA seq 401 aa AA seqDB search
MKVVPRKHKLSSFAYKGWKFFCIKKSKIKEVDVLSTRIVIKIGSSSLTGVEGGLNREAIA
YFAREISLLRAKGHEVLLVTSGAVAAGFREIGYPFRPKLLHEKQAAAAVGQALLMQAYEQ
AFKDFNLVIAQVLLTRSDFLSRKRMNNAGMTVEELLRQQVIPIFNENDTVSIDELKFGDN
DMLSALVANLVKAQHLIIITDTDGVYTADPRKHPNAVRFERIEEITEEIYALAGGSGSSV
GTGGMRSKIEAAKVATRGGVPVYVGRVSANGDLDAAVEGHGPGTYFDTHLSSLPMKKQWL
GFMSTPLGAVHVDEGAEEALVHGGHSLLPVGVRRVEGSFHAGDVVEVLGPENKVLGRGIV
NYDDEQLRMVQGLPSGEVVGKIGPIHRLEVIHRDEWITLCM
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtggtaccgcggaagcacaaactttcgtcctttgcatacaaaggatggaagttt
ttttgcattaaaaagagtaaaattaaggaagtggacgtcttgtcaacacgtatcgtcatt
aaaatcggaagcagctctctaactggagtggaaggtggcttgaatagggaagccatcgct
tattttgcccgggaaatcagcttgcttcgtgcaaaaggtcatgaagtgctgctggttaca
tcaggcgcagtagccgccggattcagagagattgggtacccgtttcgccctaagctgctg
catgaaaagcaggcggcagcggctgttggccaagctcttctcatgcaggcctatgagcag
gcttttaaagattttaacctagtgatcgcgcaggttctactgacccgtagtgactttttg
agccgcaaacggatgaataatgccggaatgaccgtagaagaattgctgcgccagcaggtt
atcccgatctttaacgaaaatgatactgtatcgattgacgaattgaaattcggcgataac
gatatgctgtccgcgctcgttgccaatctggtcaaagctcagcatctgattatcattacg
gacaccgatggcgtatacacggcagatccgcgcaaacatccgaatgccgtacgttttgaa
cgtatcgaagaaattacagaagagatttatgcattagctggaggttctggatcgtctgta
ggtactggcggcatgcgatccaagatcgaagctgccaaagtcgctacacgcggcggtgta
cctgtatatgtaggacgcgtaagcgcgaatggcgatctagacgcagccgtcgaaggacac
ggaccgggaacttattttgacacccacctctcttcacttccgatgaaaaaacagtggctt
ggatttatgtccacccctctgggcgcggtgcatgtagacgaaggggcagaggaagcgttg
gttcacggaggacacagtctacttcctgtaggcgtacgacgtgtcgagggcagctttcat
gccggagatgtcgttgaggtactcggaccagaaaataaagtgttaggacgcggcattgtc
aattatgacgatgaacagcttcgaatggtacaaggattacctagcggcgaggttgtgggc
aaaattggtcccattcaccggcttgaggtgatccacagggatgaatggattacattatgt
atgtag

DBGET integrated database retrieval system