KEGG   Paenibacillus polymyxa E681: PPE_02736Help
Entry
PPE_02736         CDS       T01319                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PPE_02736 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PPE_02736 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PPE_02736 (trpA)
Enzymes [BR:ppy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PPE_02736 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2999568..3000374)
Genome map
AA seq 268 aa AA seqDB search
MNLIDQAFGRLKNEGKTALIPFLTVGDPDVDTTIEIIRQLESAGADILELGVPYSDPLAD
GPVIQRASERALKRQISIRTCMETASLARAAGSSLPFILFTYYNPVLQMGMDAFFVGLQE
HGISGLIIPDLPLEEAEELGGRAAEVGVHLIPLVAPTSEQRIERIVRQARGFVYCVSSLG
VTGERASFFEGIEDFIAQVKRHTDIPVAVGFGISTQEQVARFSNICDGVVVGSAIVRQVE
EAIPLLNDSARRQEGLLQIHNFVAQLKQ
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaattgatcaggcgtttggtcgccttaaaaatgaaggcaaaacggcattaatt
ccttttctgacggtaggcgacccggatgtggatactacaatagagatcattcggcagtta
gagtcggccggagctgacatattggaactgggtgtaccctattccgacccgctggctgac
ggtcctgtcattcagcgcgcgtctgagcgtgcactgaaacggcaaatttccatccgcacg
tgcatggagacagcttctctggctagggcggcaggttcaagcctgccttttattctgttc
acgtactataaccctgtattacagatgggtatggatgctttcttcgtaggcttgcaggag
cacggtatcagcggtcttattattccggaccttccgcttgaggaagcggaggagctggga
ggacgggcagcagaggtaggtgtgcatctgattcctctggtggctccaacttctgaacag
cggatcgagcgaattgtccgtcaggcccgaggatttgtatactgtgtatcctcgctgggt
gtaactggggaaagagcttccttttttgaaggtattgaggactttatcgcgcaggtcaaa
cggcatacggatattccggtagcggtcggcttcgggatctccactcaagagcaggtagcc
cggttttcaaacatttgcgatggagttgtggtcggcagtgctattgtacgtcaggtggag
gaggccattccattgctgaatgattctgcgcgcaggcaagaaggtcttttgcaaattcat
aattttgtggcacaattaaagcagtaa

DBGET integrated database retrieval system