KEGG   Paenibacillus polymyxa E681: PPE_02737Help
Entry
PPE_02737         CDS       T01319                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
ppy00260  Glycine, serine and threonine metabolism
ppy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ppy01100  Metabolic pathways
ppy01110  Biosynthesis of secondary metabolites
ppy01130  Biosynthesis of antibiotics
ppy01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PPE_02737
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PPE_02737
Enzymes [BR:ppy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PPE_02737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADM70565
UniProt: E0RCJ3
Position
complement(3000371..3001567)
Genome map
AA seq 398 aa AA seqDB search
MTQLPDNNGRFGTFGGRFVPETLMNALIELEESYRKYADDPEFKAELNGLLKDYSGRETP
LYHAERLSQHLGGAKIYLKREDLNHTGAHKINNALAQGLLAKRMGKQKVIAETGAGQHGV
ATATVAALLGLECKVFMGEEDTVRQQLNVFRMQLLGAEVIPVTSGTRTLKDAGNEALRYW
VSHVHDTFYILGSAVGPHPYPMMVRDFQRVIGDETRRQILEKEGRLPDVIVAAIGGGSNA
IGMFYPFIEDQGVALIGVEAAGKGVETEFHAATMTKGTQGVFQGSMSYLLQDEYGQVQPA
HSISAGLDYPGVGPEHSYLKDIERAKYVPITDQEALDALQLLCRTEGILPALESAHAVAQ
VVKLAPTLTADDIIVICLSGRGDKDVDSIIKYLGGNPS
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgacacaattacctgataacaacggacgttttggaacatttggaggacgttttgtaccg
gaaacgttgatgaacgcgctgattgaattggaggaatcctaccgtaagtacgcggatgat
cccgagtttaaagcagagttgaacgggctcctaaaggactattctggtcgggaaacgccg
ctttatcatgcggagcgtctgagccagcatttgggcggggctaaaatttacttgaagcgc
gaagatttaaatcataccggtgcccacaaaatcaataatgcattagctcagggattgttg
gcgaagcgtatgggtaaacagaaggtcattgctgagacaggcgcaggacagcatggtgtc
gcgacagcgactgtggctgcgttgctcggattggaatgcaaggtgtttatgggcgaagag
gatactgtgcgccagcaactgaacgtctttcggatgcagcttttgggtgcagaggtcatt
ccggtgacatcgggtacacgcacacttaaggatgccgggaatgaagctttgcgttactgg
gtcagccatgtccatgatacgttctatattttgggttcagctgtcggcccacacccgtat
ccgatgatggtgcgggacttccaacgtgtgattggtgatgaaacacgtcgccagatccta
gagaaggaaggtagacttccggatgtcatcgtggcagcgatcggtggcggaagcaatgcc
atcggcatgttttatccttttattgaggatcagggtgtcgctttgattggcgtggaggcc
gctggaaaaggtgtcgaaacggaatttcatgcagccacgatgaccaagggaacacaaggg
gtcttccaaggctctatgagttatctgctgcaggatgagtacggacaagtgcagcctgcg
cattccatctcggctggactggattatccaggtgttggaccggagcattcatacctgaaa
gatattgagcgggccaagtatgttccgattaccgatcaggaagcgctggatgcgcttcag
cttctctgccgtaccgaaggaatacttcctgcattagagtcggcacatgcagttgcacag
gtcgtcaagctggcacctacgttgacggcagatgatattatcgttatttgtttgtctgga
cgcggggataaagatgtggactccattatcaagtatttgggaggaaatccgtcatga

DBGET integrated database retrieval system