KEGG   Paenibacillus polymyxa E681: PPE_02739Help
Entry
PPE_02739         CDS       T01319                                 

Definition
Indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PPE_02739
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PPE_02739
Enzymes [BR:ppy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     PPE_02739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3002231..3003025)
Genome map
AA seq 264 aa AA seqDB search
MYLDKIVVTKRQEVEQLKKHFQISEAERLIADLPATRGFENAIASGRNRSLGLIAEVKKA
SPSKGLIRPDFHPVDIARAYEGAGADCISVLTDVTYFQGSPEYLQQIRDQVKIPLLRKDF
IIDERQIYEARLLGADAVLLIAAILEPRVLGSFLQIAKDLGLDALVEVHDSEELKAVLEL
GTTTLIGVNNRNLRTFETRLQTTEELISLIPKGVTFISESGIAGPEDVNYLHSVGAHGIL
VGEHLMRKEDVGQAVAELMDGVKA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgtatcttgataaaattgtggtgacgaagcgacaagaagtggagcagcttaagaagcat
tttcaaataagtgaagctgaacgattaattgctgatttaccagcgacgagaggattcgaa
aatgcgatcgcgagcggacgcaaccgttcgcttggactgattgctgaggtgaagaaggct
tccccatccaaagggttaattcgaccggatttccatcctgtggacattgcacgtgcatat
gagggagcaggagcggattgcatttctgtactgacagatgtgacgtattttcaggggagt
cctgaatatttacagcaaattcgtgatcaggtgaagattccgctgttgcgaaaggatttt
atcattgatgaacggcaaatatatgaagctcgtctgctgggagcggatgcggtgctgttg
attgccgctatcctggaaccgcgtgtattagggtcctttttacagatcgccaaggacctc
gggctggacgcattggtagaggtgcatgacagtgaggagcttaaagcggtgctggagctg
gggacaacaaccttgattggcgtaaataaccgaaatctgcggacattcgagactcgtctc
cagacgacagaggagctgatttcactaattcctaaaggggttacgttcatcagtgagagc
ggaattgcgggaccggaagatgttaattatctgcattcggtaggtgcacacggtatcttg
gtgggggagcatctgatgcgcaaggaagatgtaggacaggctgtagccgaattgatggac
ggggttaaagcatga

DBGET integrated database retrieval system