KEGG   Paenibacillus polymyxa E681: PPE_02739Help
Entry
PPE_02739         CDS       T01319                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
ppy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ppy01100  Metabolic pathways
ppy01110  Biosynthesis of secondary metabolites
ppy01130  Biosynthesis of antibiotics
ppy01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PPE_02739
Enzymes [BR:ppy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     PPE_02739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS ThiG NanE
Motif
Other DBs
NCBI-ProteinID: ADM70567
UniProt: E0RCJ5
Position
complement(3002232..3003026)
Genome map
AA seq 264 aa AA seqDB search
MYLDKIVVTKRQEVEQLKKHFQISEAERLIADLPATRGFENAIASGRNRSLGLIAEVKKA
SPSKGLIRPDFHPVDIARAYEGAGADCISVLTDVTYFQGSPEYLQQIRDQVKIPLLRKDF
IIDERQIYEARLLGADAVLLIAAILEPRVLGSFLQIAKDLGLDALVEVHDSEELKAVLEL
GTTTLIGVNNRNLRTFETRLQTTEELISLIPKGVTFISESGIAGPEDVNYLHSVGAHGIL
VGEHLMRKEDVGQAVAELMDGVKA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgtatcttgataaaattgtggtgacgaagcgacaagaagtggagcagcttaagaagcat
tttcaaataagtgaagctgaacgattaattgctgatttaccagcgacgagaggattcgaa
aatgcgatcgcgagcggacgcaaccgttcgcttggactgattgctgaggtgaagaaggct
tccccatccaaagggttaattcgaccggatttccatcctgtggacattgcacgtgcatat
gagggagcaggagcggattgcatttctgtactgacagatgtgacgtattttcaggggagt
cctgaatatttacagcaaattcgtgatcaggtgaagattccgctgttgcgaaaggatttt
atcattgatgaacggcaaatatatgaagctcgtctgctgggagcggatgcggtgctgttg
attgccgctatcctggaaccgcgtgtattagggtcctttttacagatcgccaaggacctc
gggctggacgcattggtagaggtgcatgacagtgaggagcttaaagcggtgctggagctg
gggacaacaaccttgattggcgtaaataaccgaaatctgcggacattcgagactcgtctc
cagacgacagaggagctgatttcactaattcctaaaggggttacgttcatcagtgagagc
ggaattgcgggaccggaagatgttaattatctgcattcggtaggtgcacacggtatcttg
gtgggggagcatctgatgcgcaaggaagatgtaggacaggctgtagccgaattgatggac
ggggttaaagcatga

DBGET integrated database retrieval system