KEGG   Paenibacillus polymyxa E681: PPE_02798Help
Entry
PPE_02798         CDS       T01319                                 

Definition
pyruvate synthase subunit porA (pyruvate oxidoreductase subunit alpha) (EC:1.2.7.1)
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:ppy01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ppy00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ppy00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ppy00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ppy00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:ppy00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:ppy00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3054252..3056540)
Genome map
AA seq 762 aa AA seqDB search
MAKLEEELKQTGAAQVTTFESGNEMAATAAAQINYHMMGYFPITPSTEVAQYLDQMRTRG
QHNIKLVAADGEHGSAGICYGAAAAGARVVNATSSQGFLYMLEQLPVQSGTRFPMVMNLV
TRAVSGPLDIRGDHSDLYYGLNTGWVILTASTPQAVYDMNIMALKIAEHSDVRLPVMVAY
DGFYTSHQKRKVQYFADAETVRGFVGPNPNLNYPNITDFDHPVTVGAHMNGDDLTNNHLQ
LSEALKLSEGVYEQVAAEYAALSGREYSILDLYHMEDAEVAVFLLNSAAESAKDVADQLR
ARGIKAGVIRPNIIRPFPAAQLREALRDVKALLVGERADSYGADGGNLTHEIKAALQEDP
LNRTLVLSRIFGLGGKDFYAEDAEAFFQLAIEAAEAGRAEKPFDYYGINPGSPDKVMPQV
MQPPRGNAYRTGLIQVTPDEATGKLKVKVPPLRSLTTKPRRLTPGHGACPGCGALSALEL
FFKGIEGDIVVLFQTGCVYVTTTGYPYTSHKQPMIHNLFQNGAATLSGALEAYMEMKRRN
EIEMSDDPTFIMISGDGGMDIGMGSAIGAALRNHKLIMLEYDNEGYMNTGSQQSYSTPVG
HMTSTSGVGKMQKGKQGHHKDTVQIMAACNIPYAFTAAESHPQDMLRKAAKAQWYANNVG
TAYGKILCACPLNWKSEDRLGTSIVGAAVESCFFPLYEIEQGSTTITYNPEDKGKRIPAA
EWLKLMGKTKHLLKEEATLATFEQEIERRWTTLKKKHEISEL
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactggaggaagaactcaaacagacaggcgccgcgcaagtgacaacgttcgaa
tccggtaatgaaatggcagctacggcggctgcgcagattaattatcatatgatgggatat
ttcccgataactccatctaccgaggtagcgcagtatctggatcagatgagaacgagaggt
cagcataatattaagctggttgcagcagacggagaacacggatcggcagggatttgttat
ggagctgccgcagcgggagcgagggttgtgaacgcgactagttcgcaaggtttcctgtac
atgctggagcagttacctgttcagtcaggtacccgttttccaatggttatgaatctggtg
acacgagctgtcagtggtcccctggatattcgcggggatcattcggacctttactatggt
ttgaatacaggctgggtcattttgacggcaagtacaccacaggctgtgtatgatatgaac
atcatggcactaaaaatcgcagagcatagcgatgttcggttgcctgtaatggtcgcatat
gacggtttttatacgtctcatcaaaaacgtaaagttcaatattttgccgatgctgagacc
gtgcgcggttttgtaggtcctaacccgaacttaaattatccgaatattacggattttgat
catcctgttaccgtgggtgcgcatatgaacggtgatgacctgacgaataatcatcttcag
ctatccgaagcactgaagctgtcagaaggagtatatgagcaggtagcagcagaatatgcc
gctttatccggtcgggaatactcgattttggatctgtatcatatggaggatgctgaggtc
gcggtattcctgttgaattcggcggctgaatcggccaaggatgtggcggatcaactccgc
gcgcgcgggattaaagctggtgtgatacgtccgaatatcatccgaccgttcccagccgca
caactacgggaagcattgcgcgatgtcaaggcgctgctggtaggtgaacgtgcagattcg
tatggggcagacggcggtaatttaacgcatgaaattaaagcggccttgcaggaggacccg
ctgaaccggacactcgtgttgagccggatatttggcttgggcggcaaggatttttatgca
gaagatgcagaggcgttctttcagcttgcgattgaggcggcagaggccggacgagccgag
aagccctttgattattacggaattaatccgggttcaccggataaggtgatgccgcaagtt
atgcaaccgccacgtggcaatgcataccgtacaggtctgattcaggttacgccggacgag
gcgaccgggaagctcaaagtcaaggtaccaccccttcggtcgttgacaaccaaaccacgc
cgtcttacaccaggtcacggggcttgcccaggatgtggggcattgtctgcgctggaactg
tttttcaaaggtattgaaggggatattgtcgtgctgttccagacaggctgcgtatatgtg
acgacgacagggtatccatatacatcacacaaacaaccgatgatccacaatctttttcaa
aacggggccgctacactttcaggagcgctggaagcttatatggaaatgaagcgccgcaat
gaaattgaaatgtcggacgatccgacctttatcatgatcagtggtgacggtgggatggat
attggtatgggttctgcgattggtgcggctctgcgtaatcataagctgatcatgctggaa
tatgataacgaagggtacatgaatacaggttcacagcaatcgtactccactccggttggt
cacatgactagtacgtcgggtgtaggaaaaatgcaaaaaggaaagcaagggcatcacaag
gatacggtgcaaatcatggctgcttgtaacattccgtatgcttttacagcagctgaaagt
catccgcaggatatgctgcgcaaagcagccaaggctcaatggtatgcgaacaacgtgggt
acggcctatggtaagatcctgtgcgcctgcccgctgaattggaaatccgaagacagactg
ggcaccagcattgtgggggccgcagtcgagtcctgtttctttcctttgtacgaaatagag
caaggcagtacgacgattacgtataatccggaagacaagggaaaacggattccagctgca
gaatggttgaaattaatgggtaaaacgaagcatcttctcaaggaggaggctacgctggct
acctttgagcaggagattgagcgtcgctggactaccctgaaaaagaaacatgaaatttcg
gagctataa

DBGET integrated database retrieval system