KEGG   Paenibacillus polymyxa E681: PPE_02875Help
Entry
PPE_02875         CDS       T01319                                 

Definition
Aldehyde-alcohol dehydrogenase 2 (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PPE_02875
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPE_02875
   00620 Pyruvate metabolism
    PPE_02875
   00650 Butanoate metabolism
    PPE_02875
  Lipid metabolism
   00071 Fatty acid degradation
    PPE_02875
  Amino acid metabolism
   00350 Tyrosine metabolism
    PPE_02875
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PPE_02875
   00626 Naphthalene degradation
    PPE_02875
Enzymes [BR:ppy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PPE_02875
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     PPE_02875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3131882..3134494)
Genome map
AA seq 870 aa AA seqDB search
MAVKNEVIQKEQSAEQYIQTLIDRGNRAQQAFMSMNQEQIDEIVQAMALAGMDKHMYLAK
LAVEETGRGVYEDKITKNMFATEYIYHSIKNEKTVGVIEDNDFDSFQKIAEPVGIIMGIT
PVTNPTSTTMFKALIAIKTRNPIIFGFHPSAQSCSAEAARVLLEAAVKHGAPADCIQWIE
APSMDKTNVLMNHPDVALILATGGSGMVKAAYSCGKPALGVGPGNVPCFIEKTADIKQAV
NDLILSKSFDNGMICASEQAVIIEEPIFEQVKKLMIANGCYFVNKEEAAKLTQGAMNVEK
CAVNPAIVGQSAVKIAEMSGITVPAGTKILVAEIEGVGTKFPLSAEKLSPVLACYKVKNA
EQGIQRAAEVVEFGGMGHSSAIHSNDEDVIARFANRLQTGRIIVNAPSTHGAIGDIYNTN
LPSLTLGCGSYGRNSTSSNVSAVNLINVKRVAKRTVNMQWFKVPSKIYFEKNSTQYLAKM
PDITRVAIITDPMMVQLGYVDRVIHYLHQRQTPVAIEVFSEVEPDPSTVTVERGTEMMRR
FQPDCIIALGGGSPMDAAKGMWMFYEYPDTDFNNLKQKFMDIRKRIYKYPRLGQKAQFVA
IPTTSGTGSEVTSFAVITDKNLGNTKYPLADYELTPDVAIIDPVFVYSLPKTAVADTGMD
VLTHAIEAYVSVMANDYTDGLAIKAIQLVFQYLEQSALTGDKLAREKMHNASTLAGMAFA
NAFLGINHSLAHKWGGQYHTAHGRTNAILLPHVIRYNAKKPTKFASFPKYSHFVADERYA
EIARILGLPARTTEEGVNSLIEAIRKMNKTLGIEESFQQIGFDAKDFESRVDYLADRAFE
DQCTTANPKLPLVTELADVYRNAFYGRFDQ
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atggctgttaaaaacgaggttatccaaaaagagcaaagcgcagagcagtatattcaaacg
ctgattgaccgggggaaccgggcacagcaagctttcatgagtatgaatcaggaacagatt
gacgaaatcgtacaagctatggcacttgcagggatggataaacacatgtacctggcgaag
ttggctgttgaagaaacaggacgcggtgtgtacgaggacaaaatcaccaaaaacatgttt
gcaacagaatatatctatcatagtatcaaaaatgaaaaaaccgttggtgtcattgaggac
aatgattttgacagttttcaaaagatagcagagccagtcggcattatcatggggatcact
ccagtgacaaacccgacttcgactacgatgttcaaagcgttgattgccattaaaacacgt
aacccaatcattttcggtttccatccatctgctcaatcgtgtagtgcggaagcagcccgc
gtcttgctcgaagcagctgttaaacatggtgctccagctgattgtattcaatggattgaa
gcaccttcgatggataagaccaatgtactgatgaaccaccctgatgtggcgctgattctg
gcaactggtggatcaggcatggttaaggcggcatatagctgcggtaaacctgctctgggt
gtaggcccaggtaacgtgccttgctttattgaaaaaacagcagacatcaagcaggccgtg
aacgatctcatcctctctaaatcttttgacaacggtatgatttgtgcttccgagcaagcg
gttattatcgaagagccaatcttcgaacaagtgaaaaaattgatgatcgctaacggctgc
tattttgtaaataaagaagaagcagctaagctcactcaaggagctatgaatgtcgagaaa
tgtgcagtgaacccagcaatcgtcgggcagtctgctgtgaaaattgctgaaatgagtggt
atcacagtaccagcaggaactaaaattttggtcgctgagattgaaggggtaggaacaaaa
ttcccattgtctgcggaaaaattaagtcctgtattggcttgctataaagtaaagaatgcg
gaacaaggtattcaacgcgctgctgaagtcgtggaattcgggggcatgggccactcgtcc
gctattcattcgaacgatgaggacgttattgctcgcttcgcaaaccgtctgcaaacagga
cgtatcattgtaaatgcaccttccacacatggtgcgattggcgacatttacaacaccaat
cttccttcgttgacactcggttgcggttcgtacggtcgtaactcgacttcgtcgaacgta
tcggcagtcaatttgattaatgtgaaaagggtggcgaaacggacggtgaatatgcaatgg
ttcaaagtaccttccaaaatctattttgagaaaaactcgacacagtatcttgctaaaatg
cctgatatcacacgtgtagccattatcacggaccctatgatggtacaactgggatatgta
gatcgtgttattcattatctgcatcaacgccaaacaccggtagctatcgaagtgttctct
gaagtagagccagatccatcgacagttacggtagaacgtggtacagaaatgatgagacgt
ttccaaccggattgcatcatcgcactgggcggcggttcgccaatggatgcggctaaaggc
atgtggatgttctatgaatatccagatactgatttcaataacttaaaacaaaaattcatg
gatatccgtaaacggatttacaagtacccacgtctgggccaaaaagcgcaatttgtagcg
atccctacaacctcgggtacaggttccgaagttacatcgttcgcagtaattacggacaaa
aacctgggcaacacgaagtacccgctggctgactatgagttgactcctgatgtggcaatt
attgacccagtgtttgtatattcgttgcctaaaacagctgtagcggacacaggtatggac
gttctgacacatgctatcgaagcttatgtgtccgtaatggctaatgactacacagacggt
ctggcgattaaagccattcaattggtattccaatacctggaacaatcggctctgacaggt
gataagctggctcgtgaaaaaatgcataatgcttccacacttgctggtatggcatttgct
aatgcattcttgggcattaaccacagtcttgcacataaatggggtggacaataccataca
gctcatggccgcacgaatgccattttattgccgcacgtcattcgctataatgcgaaaaaa
ccgacaaaatttgcttcgttccctaaatattcgcactttgttgcggatgagcgttatgca
gaaatcgcgcgcatactgggactgcctgcacgcaccaccgaagaaggtgttaacagcttg
atcgaagcgatccgtaagatgaacaaaacacttggtatcgaggaatcgttccaacaaatc
ggtttcgatgctaaggatttcgaatcgcgtgtagattatctggctgaccgcgcttttgaa
gatcaatgtacaactgcgaatccgaagttgccgctggttactgagttggctgatgtctat
cgcaatgccttctacggacgttttgaccaataa

DBGET integrated database retrieval system