KEGG   Paenibacillus polymyxa E681: PPE_02922Help
Entry
PPE_02922         CDS       T01319                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PPE_02922
Enzymes [BR:ppy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     PPE_02922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3179437..3180009)
Genome map
AA seq 190 aa AA seqDB search
MAKGLLFVISGPSGVGKGTVGNALRDKLPEITYSVSATTRTPRSGEQDGVTYFFKTREEF
LGMIERDEMLEYAEYVGNYYGTPRDFVDQTLAQGKDIFLEIEVQGALKVKEKFPEGIFIF
LLPPSLDELKDRIRGRGTETQATIDHRMSVAVDEMNLLRHYDYAVVNDEIDFACKRIESI
IIAEHCKVHP
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggctaagggattattatttgtaatatccggaccttcgggtgtcggtaaagggacggta
ggcaacgcattgcgtgacaagctaccagagataacatactccgtttctgctacaactcga
acacctcgttcaggtgaacaggatggagtgacctacttttttaaaacgcgtgaagaattt
ttgggtatgattgaacgagacgaaatgctggagtatgctgagtatgtaggaaactattat
ggtactccacgtgattttgtagatcagacgcttgcgcaaggaaaagatatttttctggag
attgaagttcagggagccttaaaggttaaagaaaaattcccagaaggcatattcattttt
ctgcttccgccttcgctagacgaattaaaggatagaatccggggacggggcacagaaact
caagcgaccatagaccaccgtatgtcggtagctgtggatgaaatgaatttgttacgtcac
tatgattatgcggtcgtcaatgatgagattgatttcgcttgtaaacgaatagaatccatt
attatcgccgaacattgtaaggttcatccttaa

DBGET integrated database retrieval system