KEGG   Paenibacillus polymyxa E681: PPE_02952Help
Entry
PPE_02952         CDS       T01319                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
ppy00010  Glycolysis / Gluconeogenesis
ppy00620  Pyruvate metabolism
ppy00640  Propanoate metabolism
ppy00680  Methane metabolism
ppy01100  Metabolic pathways
ppy01110  Biosynthesis of secondary metabolites
ppy01120  Microbial metabolism in diverse environments
ppy01130  Biosynthesis of antibiotics
ppy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPE_02952
   00620 Pyruvate metabolism
    PPE_02952
   00640 Propanoate metabolism
    PPE_02952
  Energy metabolism
   00680 Methane metabolism
    PPE_02952
Enzymes [BR:ppy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PPE_02952
Lipid biosynthesis proteins [BR:ppy01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PPE_02952
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADM70777
UniProt: E0REX1
Position
complement(3217083..3218798)
Genome map
AA seq 571 aa AA seqDB search
MKIDELQTVVPTSNMGPYEQAYNNFQWEDAERHFTWYETGKVNMAHEAIDRHVQEGRGEK
AALLYCDANRHETYTFSQLRASSNRFGNVLRKYGIGKGERVFIFMPRSPELVISLLGVLK
VGAVVGPLFEAFMETAVKDRLEDSGAVALVTTPALLSRVKREELPELRHIFVVGDMDERE
QGIIDFETEMLMSSEELEPEWLNREDGLIIHYTSGSTGKPKGVYHVQNAMIQHYYTGKMV
LDLREDDVYWCTADPGWVTGTSYGIFAPWLNGATNVIRGGRFSPEDWYRTIERHEVTIWY
SAPTAFRMLMSAGEQVVSKYDLSSLRHVLSVGEPLNPEVVRWGWQVYTQRIHDTWWMTET
GAQLICNYPELTIKPGSMGKPLPGIQAGILDDRGQVLPPNRMGHLAIRTPWPSMMNRIWN
NPNKFQEYFRFPGWYVSGDSAYMDEDGYFWFQGRIDDVINSSGERIGPFEVESKLLEHPA
VAEAGVIGKPDTVRGEIIKAFVALREGYAPSEALQQDIYRFVKEGLSAHAAPREIEFKEK
LPKTRSGKIMRRVLKAWELNLPTGDLSTIED
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgatgaactccagactgtagttcccacatccaacatgggcccgtatgaacaa
gcttacaacaactttcagtgggaggatgcagagcgtcattttacgtggtatgaaacaggc
aaggtaaatatggcacatgaagccattgatcgacatgtacaggaaggacgaggtgagaaa
gcggcactattgtattgtgacgcaaaccgtcatgaaacctacaccttctctcagcttcgt
gctagctctaacaggttcggaaatgtgctgcgcaaatacggtattggtaaaggggagcgg
gtgtttattttcatgccgcgttcacccgagctggttattagtttacttggtgttctaaag
gtaggggctgttgtaggtccattgtttgaggcgtttatggaaactgcggttaaggatcga
ttggaggatagtggggcagtagcattagtgactacacctgcgcttctgtcacgggtgaaa
cgtgaggagcttcctgagctgcggcatatttttgtggttggtgatatggatgaacgcgag
cagggaattatcgattttgagacagaaatgcttatgtcctcagaggaacttgagcctgaa
tggttgaatcgtgaagatggattaattattcactatacatcaggctcaacaggtaagcct
aaaggcgtgtatcatgtgcaaaatgcaatgattcagcattactatactggaaaaatggtg
ctggatttgcgggaagatgatgtgtattggtgtactgctgatcctggctgggtcacggga
acgtcatacggtatttttgctccatggctaaatggagcgacgaatgtcattcgtgggggg
cgtttcagcccggaagactggtaccgtacgattgagcgtcacgaagtgaccatatggtat
agtgctcctacagcgtttcggatgctgatgagcgcaggggagcaggttgtttccaaatat
gatctcagcagtctgcggcatgtattatccgttggggaaccgctgaatcccgaagtggtg
cgatggggatggcaagtatatacacagcgcattcatgatacttggtggatgacggaaaca
ggagcacagttgatctgtaattaccctgagctgacgattaagccgggttcgatgggaaag
ccactcccaggtattcaggctggtattctggacgacagagggcaggtgttgcctcctaac
cggatgggccacttggcgatccgtacaccatggccatccatgatgaatcgtatatggaac
aatccgaacaagtttcaggaatatttccgctttcccggttggtatgtatcgggtgattca
gcttacatggatgaagacggatatttctggtttcagggtaggattgatgatgtcattaac
tcttccggggagcgaatcggcccttttgaggtggagagcaagcttctggagcatcctgct
gtagcggaagccggagtcattggaaaaccagataccgtgcggggagagattatcaaggca
tttgttgcactgcgtgaaggctatgcaccgtctgaagctttacagcaggatatctatcgc
ttcgttaaggaagggctgtctgctcatgctgctccacgcgaaattgagtttaaggaaaag
ctacccaaaacccgttccggtaaaattatgagacgcgtgttgaaagcctgggagcttaac
cttcctacaggtgacttatctaccatagaggattga

DBGET integrated database retrieval system