KEGG   Paenibacillus polymyxa E681: PPE_03086Help
Entry
PPE_03086         CDS       T01319                                 

Definition
pectin methylesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PPE_03086
   00500 Starch and sucrose metabolism
    PPE_03086
Enzymes [BR:ppy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     PPE_03086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3386710..3387666)
Genome map
AA seq 318 aa AA seqDB search
MLVGKESFCDFHTIQEAIAVLEHSSSNEMETLTILSGTYEEEVRIYRSYLHIIGIGQVEI
RMDRYAKERDEAGEEIGTFATPTLFLGGSHLILENLTISNTAGQGEAIGQAVAVYAHCDE
TVFRNCTFKGHQDTLFTGPLPPAPKERLQFGGIHLKEHHRHYRQLYQHCYIEGTVDFIFG
GATAYFEDCEIRSLRHHENQTSYVTAASTPQGQAYGYVFNYCYLTAEADITPVFLGRPWR
EYAKTVFVDCKMGDHIDPRGWDNWNNVANEKTVCYQEYNGPDEVATLRKQRVPWADCFEA
GTEAWSKEQVFAEVTFWK
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgctagttggaaaagaatccttttgtgatttccatacgattcaggaggcgattgccgtg
ttagagcattcttcttccaatgaaatggaaacgctaactattttatcaggtacttatgag
gaagaggtacgaatttaccgttcatatcttcatattataggcatcgggcaggtagagatt
cgaatggatcggtatgccaaggagcgggatgaagcgggtgaggaaatagggacctttgcg
acaccaactttatttttaggcggtagccatctgatcttggaaaatctcacgatttccaac
acggcaggacagggagaagccattgggcaggccgttgcggtatacgctcattgtgatgaa
acagtctttagaaactgtacctttaaagggcaccaggatactttatttacaggccctcta
cctcctgcaccgaaagaacgactccagtttggtggaatccatttgaaggagcatcatagg
cactatcggcagctctatcagcattgttatatagagggtacggtggactttatttttggt
ggggctaccgcgtattttgaagattgtgagattcgcagtttacgccatcatgagaaccaa
acgagctacgttacagctgcctctacgccacaaggacaagcgtatggttatgtatttaac
tattgctacttaaccgcagaagctgatattaccccggtttttttgggacgtccgtggcgg
gaatatgccaagaccgtatttgtcgattgtaaaatgggcgatcatattgacccacgtggc
tgggacaattggaacaatgttgcaaacgagaaaacggtctgttatcaggaatataacgga
cccgatgaagttgctacgttacgtaagcagcgtgttccgtgggcggattgttttgaggcg
ggaacagaagcatggagcaaggaacaggtttttgctgaagtcacattttggaagtaa

DBGET integrated database retrieval system