KEGG   Paenibacillus polymyxa E681: PPE_03086Help
Entry
PPE_03086         CDS       T01319                                 

Definition
pectin methylesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:ppy00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ppy00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3386710..3387666)
Genome map
AA seq 318 aa AA seqDB search
MLVGKESFCDFHTIQEAIAVLEHSSSNEMETLTILSGTYEEEVRIYRSYLHIIGIGQVEI
RMDRYAKERDEAGEEIGTFATPTLFLGGSHLILENLTISNTAGQGEAIGQAVAVYAHCDE
TVFRNCTFKGHQDTLFTGPLPPAPKERLQFGGIHLKEHHRHYRQLYQHCYIEGTVDFIFG
GATAYFEDCEIRSLRHHENQTSYVTAASTPQGQAYGYVFNYCYLTAEADITPVFLGRPWR
EYAKTVFVDCKMGDHIDPRGWDNWNNVANEKTVCYQEYNGPDEVATLRKQRVPWADCFEA
GTEAWSKEQVFAEVTFWK
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgctagttggaaaagaatccttttgtgatttccatacgattcaggaggcgattgccgtg
ttagagcattcttcttccaatgaaatggaaacgctaactattttatcaggtacttatgag
gaagaggtacgaatttaccgttcatatcttcatattataggcatcgggcaggtagagatt
cgaatggatcggtatgccaaggagcgggatgaagcgggtgaggaaatagggacctttgcg
acaccaactttatttttaggcggtagccatctgatcttggaaaatctcacgatttccaac
acggcaggacagggagaagccattgggcaggccgttgcggtatacgctcattgtgatgaa
acagtctttagaaactgtacctttaaagggcaccaggatactttatttacaggccctcta
cctcctgcaccgaaagaacgactccagtttggtggaatccatttgaaggagcatcatagg
cactatcggcagctctatcagcattgttatatagagggtacggtggactttatttttggt
ggggctaccgcgtattttgaagattgtgagattcgcagtttacgccatcatgagaaccaa
acgagctacgttacagctgcctctacgccacaaggacaagcgtatggttatgtatttaac
tattgctacttaaccgcagaagctgatattaccccggtttttttgggacgtccgtggcgg
gaatatgccaagaccgtatttgtcgattgtaaaatgggcgatcatattgacccacgtggc
tgggacaattggaacaatgttgcaaacgagaaaacggtctgttatcaggaatataacgga
cccgatgaagttgctacgttacgtaagcagcgtgttccgtgggcggattgttttgaggcg
ggaacagaagcatggagcaaggaacaggtttttgctgaagtcacattttggaagtaa

DBGET integrated database retrieval system