KEGG   Paenibacillus polymyxa E681: PPE_03105Help
Entry
PPE_03105         CDS       T01319                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (aspartate transcarbamylase) (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PPE_03105 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PPE_03105 (pyrB)
Enzymes [BR:ppy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     PPE_03105 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3408201..3409115)
Genome map
AA seq 304 aa AA seqDB search
MITTASQLKERSLLGLKELSRNEIESILDRAHYWESQPEKLVPVLQSRFAANMFFENSTR
TRFSFEMAEKRLGAQVLNFSAAASSVEKGESIYDTVRTLESMGIDAGVIRLKPAGVLQEL
AEKVSVPLVNAGDGNNEHPTQALLDLYTMRKTFGELKGLRVSIIGDILHSRVARSNLWAL
QKFGAKVSFCAPDNMQAPDLAAYAPYVPMQEALQADVVMMLRVQLERHAEGMLRSADEYR
EQYGLTEKRAANLKPGTIIMHPAPVNRDVEIDSAVVESEQSRIFPQMANGVPIRMAVMER
AMKL
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgatcacaacagccagtcaacttaaagaacgtagcctgctcgggttaaaggaacttagc
cgaaatgaaatcgagtccattctggatcgcgctcattattgggagtctcaaccagaaaaa
ctggttccagtactgcaatcacgctttgcggccaacatgttttttgaaaacagcactcgc
acccgcttttcttttgaaatggcagagaagaggctgggcgctcaggttttgaacttttcc
gctgcggcttccagtgtggaaaaaggggagtccatttacgatacagtacgtacgctcgaa
tccatgggcattgacgcaggagtcatccggttaaagccagccggggtgctgcaagagctc
gctgagaaggtcagtgtcccactggttaatgcgggggacggcaacaatgagcatccaaca
caggctctgctggacctgtacaccatgcgcaaaactttcggtgagcttaaaggcttgaga
gtatccattataggagacattctgcacagccgtgtcgctcgctcgaatctgtgggccttg
caaaaattcggagccaaggttagcttctgcgctcctgataatatgcaagcacctgatctt
gcggcgtacgcgccttatgttccgatgcaagaggcactacaggcggacgtggtcatgatg
cttcgggtacagctggaacggcatgccgaagggatgttgcgctcagcggatgagtaccga
gagcagtacggtttgacagagaaaagagcagcgaacctgaagcccggaacaattatcatg
catccagctccagtgaatcgggatgtggaaattgatagtgcagttgtggaaagcgaacaa
tcacgaatttttccgcaaatggcaaacggggttccgatccgcatggcggttatggaacgg
gcaatgaagctgtag

DBGET integrated database retrieval system