KEGG   Paenibacillus polymyxa E681: PPE_03132Help
Entry
PPE_03132         CDS       T01319                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:ppy00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ppy00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3435930..3437417)
Genome map
AA seq 495 aa AA seqDB search
MQLQQLASLLAVSRVVGDGTVDCRGIGADSRRVQQGDLFLCLPGFTVDGHDYAEQAIASG
AAALVVERELDVPVPQLVVKDARHAMAVLADYMFDSPSRRMRMIGITGTNGKTTITYLIE
KIMKDAGVNTGLIGTIQMRYGGQSYPMSGTTPEAVELQRYLGNMAEQGVQCCVMEVSSHA
LEQGRVKGTDFRTAIFTNLTQDHLDYHNTMEEYRAAKGLLFSRLGNAFSRDASDSKYAVL
NADDPASSYLQAQTAAQVITYGVEKESDVQASSITIGSKGTSFHVSTFKGDTDIELRMVG
KFNVYNALAAITAALLEGISLVDIKRSLESIAGVDGRVEPVDAGQPFAVIVDYAHTPDGL
ENVLRTVKEFAVGKVWCVFGCGGDRDRTKRPLMGKIAARYSDHSFITSDNPRTEDPKVIL
KDIEQGLIDEGVPAERYELIVDRRTAIHKAVEMASPDDVVLIAGKGHETYQLIGKTVHEF
DDRIVAKEAIRGLSK
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcagcttcaacaattggcttcactgctggccgtctcccgtgtggtgggtgacggtaca
gtggattgccgaggaatcggggcggattcacgtcgagtgcaacagggggatttatttctg
tgtttgccaggttttacagtggacggacatgactatgctgagcaggcaattgcgtccggg
gcggcagctttggtcgttgaacgtgaactggatgtacctgttccgcagcttgtagttaag
gatgcacgacatgccatggcggttttggcggattatatgtttgattcaccgagccgacgc
atgcgcatgatcggcataaccggaaccaatggtaaaacaacgataacttatctgattgaa
aagatcatgaaggatgccggggtgaacaccggactgattggtacgattcaaatgcgttac
ggtggtcagtcttacccaatgtctggcactacgcccgaagcggtggaactgcaacgttat
ctcggaaatatggcagagcagggggttcaatgctgtgtcatggaagtatcctcacatgcg
ttggagcagggccgcgtcaaaggaactgattttcgcaccgctatatttacaaacctgacg
caggaccacctggactaccacaacacaatggaggagtaccgtgctgcaaaaggactttta
ttctctaggttgggaaatgctttctcgcgggatgcatcagatagcaaatatgctgttctg
aatgcagacgatccggcttcttcctatttgcaggctcaaactgcggcccaagtgattaca
tacggcgtggaaaaggagtctgatgtgcaggcatctagtatcactataggttccaaggga
acctccttccatgtgtctacttttaaaggagatacagatattgagcttcgaatggtgggc
aagttcaatgtgtacaacgcactggcagccattacagctgctttgctggaaggaatctcg
ctggtggatatcaagcggagtctagagtctatcgcaggcgtagatgggcgggtagagcct
gtagatgcgggtcagccctttgctgttattgtagattatgcccatacaccggacggattg
gaaaatgtccttcgcaccgtaaaggaatttgcggtcggtaaagtatggtgtgtatttgga
tgcggcggtgaccgagatcgtacgaaacgcccattgatggggaaaattgctgcgcgttac
agcgaccactcatttattacttccgacaatccgcgaacagaggacccgaaagtgattttg
aaagacatcgaacaagggctgattgacgaaggtgtacccgcagaacgatacgaattgatc
gtggatcgcagaactgcaattcataaagctgttgaaatggcaagccctgacgatgtagta
ttgattgcgggaaaaggtcatgagacttaccagttgatcggaaaaacggtgcatgaattc
gatgaccgcatcgtagccaaagaagcgataaggggtttatccaagtga

DBGET integrated database retrieval system