KEGG   Paenibacillus polymyxa E681: PPE_03372Help
Entry
PPE_03372         CDS       T01319                                 

Definition
beta-glucosidase (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ppy00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3683471..3684928)
Genome map
AA seq 485 aa AA seqDB search
MKNTTTLEFPQGFLWGGATAANQFEGGYNEEGKGLSTADVITAGTHTTSRRITPILEKGV
NYPSHEAIDFFHRYQEDIRLFAEMGFKVFRMSIAWSRIFPNGDDAEPNEQGLQFYDRIFA
ELKKYNIEPLVTISHYEAPFHLTQKYNGWSDRRVVDFYVRYCEVLFNRYKDVVKYWLTFN
EINILTLSFGAFMAGAMMPEGNGELAHATVKDEQVLYQALHHQFIASAKAVKLGHEINKD
FKIGCMIAYMCSYPLTCHPDDILLAQQKDNLSNFLCSDVQVRGAYPGFAKRYFRDHNIQI
NMQEEDEDILKDGCVDFYTFSYYSSTCVSADPNQEKVGGNLSMGLKNPHLKASAWDWQID
PQGLRWSLNNIYNRYEIPLMVVENGLGAVDTVEEDGSIHDDYRIDYLKQHIEQMKEAIAD
GVDLIGYTPWGCIDLVSAGTGEMKKRYGFIYVDKDNEGKGTLARSRKKSFYWYKNVIETN
GEQLD
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatacaactacattggaatttccacaaggatttttatggggaggtgcaacggct
gccaaccaatttgaaggtggatataatgaagaaggtaaaggcctaagcactgctgatgtg
attacggctggaacgcatacgacttcccgaagaattacacctatactggaaaaaggagtg
aactatccgagtcacgaggctattgattttttccaccgctatcaagaggatatccgctta
tttgcagagatgggattcaaggtctttagaatgtccattgcgtggtcaagaatatttcct
aacggagatgatgcagagccgaatgagcaaggcttgcagttctatgatcgtatattcgca
gaattgaaaaagtataatattgagcctttggttacgatctcacattatgaagcaccgttt
catttgacccaaaaatataatggttggtcagatcgcagagtcgtagatttttatgtgaga
tattgtgaagtgctttttaacagatacaaagatgtcgtaaaatactggttaacctttaat
gaaatcaatattttaaccttgtcatttggcgcgttcatggctggagctatgatgccggag
gggaatggagagcttgcccatgctacagtgaaggatgagcaggttctgtatcaggcgttg
catcatcaatttattgccagtgcaaaggctgtaaagctgggtcatgaaatcaacaaggac
tttaaaatcggttgtatgattgcttatatgtgttcctacccacttacatgtcatcctgat
gatattctactggctcaacaaaaggataacttaagtaatttcctatgctcagatgttcaa
gtaagaggagcttatccgggttttgccaaacgctattttagagatcataacattcagatc
aatatgcaagaagaggatgaggacatcttaaaagatggctgcgtagatttctataccttc
agctattattcctctacttgtgtcagtgccgatcccaaccaggagaaggtgggagggaat
ttatctatgggcttaaagaatcctcatttgaaagcaagtgcctgggattggcagatcgat
ccacagggattgagatggtcccttaataacatttataaccgatatgaaatcccgttaatg
gttgttgaaaatggccttggcgccgtagatacagtggaagaagacggctccattcacgat
gattatcgaattgattatctaaagcaacacattgagcaaatgaaagaagcgattgctgat
ggagtagacttaatagggtatacgccttggggatgtattgatctggtaagtgcgggaacc
ggtgaaatgaaaaagcgttatgggtttatatacgtcgataaggataatgaaggcaaaggg
acacttgccagatccagaaagaagagcttttattggtataagaatgtgatcgaaaccaat
ggagagcagctggattaa

DBGET integrated database retrieval system