KEGG   Paenibacillus polymyxa E681: PPE_03431Help
Entry
PPE_03431         CDS       T01319                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (TS) (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PPE_03431 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PPE_03431 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PPE_03431 (thrC)
Enzymes [BR:ppy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PPE_03431 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3740505..3741896)
Genome map
AA seq 463 aa AA seqDB search
MRYISTRGRVEAKGFIDTVLMGLADDGGLMVPEQIPTVSAATLEQWATLSYRELLLEVFA
LYINDEIPREDLEQLVERSYASFRHPEVTPVKKINDSLSILELFHGPTFAFKDVALQFMG
EFYSYVSKKQNEIIHILGATSGDTGAAAIQGVRGKEGIKICILHPHQKVSKVQELQMTTV
DDENVLNLSVKGNFDDCQKVIKDLFADLDFKAKHHLRAINSINFVRILAQTVYYFYAYFR
AQESAGNKKINVSVPSGNFGNIFSGFLAKKMGLPIHKLIIATNENNILERFVKTGEYQPG
DFKSTYSPSMDIQVASNFERYLYYFLGEDAAKVSEYMNNLKTEGRIVISAEDLKRVQQDF
EALGASNEQCLELIKKYKAEYDYLLDPHTACGIAAYEAYNGADEVCVTFATAHPAKFDEA
IRLVDIKQEFPAPIEQLFSKPQHQQVVEHDEAEIVRQLEAFYV
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgagatatataagcactagaggtcgagtagaagccaagggatttattgataccgtgctc
atggggttagctgacgatggaggtctgatggtaccggagcagattccaaccgtgtcggca
gctacgttagagcaatgggctacattgagctacagagagctgctgctggaagtttttgcg
ctgtatatcaatgatgaaattcctcgtgaagatttggaacaactggtggagcgcagttat
gcgagcttccgtcacccggaagttacgccagtgaagaagatcaacgattccctgtctatt
ttggagctgttccacgggcctacgttcgcgttcaaggatgtggcgctgcaatttatgggt
gagttttattcctatgtgtccaaaaagcagaatgagatcattcacattttgggtgcaacc
tcaggcgatactggggcagcagccattcaaggcgtacgaggcaaggaaggcatcaaaatc
tgtattttgcatccgcatcaaaaagtgagtaaggtacaagaactgcaaatgacgacggta
gacgatgagaacgtgctgaatctatctgtaaaaggaaactttgacgattgtcaaaaagtg
attaaggacctgttcgctgatttggacttcaaagccaaacatcatctgcgggcgattaac
tcgattaactttgtgcgtattttggcgcagacggtatattatttctatgcttatttccgg
gcgcaagagtctgcgggtaacaaaaagatcaatgtcagtgtgccatccggcaactttggc
aatattttttccggctttcttgcgaagaaaatgggcttgccgatccataagctgatcatt
gcaacgaatgaaaataatattttggagcgcttcgtgaagacaggcgaataccagccgggc
gactttaaaagcacatacagtccttcgatggacattcaggtggcgagcaacttcgaaaga
tacctgtattacttcctcggtgaggatgcagccaaggtatctgaatacatgaataacctc
aaaaccgaggggcggattgtgatcagtgcagaggatttaaaacgggtgcaacaggatttt
gaagcgctcggtgcttcgaatgagcagtgtctggagctgatcaaaaaatacaaggctgaa
tacgattatttgctcgatccgcatacggcttgcggtattgccgcgtatgaggcgtataat
ggcgcggacgaagtctgtgtgaccttcgcgacagcacatccggccaaatttgatgaagcc
attcgtctggtggacattaagcaggagtttccggcgccaattgaacaattgttctccaag
ccacaacaccagcaggtggtagagcatgacgaggccgaaattgtgcgtcagcttgaagcc
ttttatgtgtaa

DBGET integrated database retrieval system