KEGG   Paenibacillus polymyxa E681: PPE_03461Help
Entry
PPE_03461         CDS       T01319                                 

Definition
endo-1,4-beta-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PPE_03461
Enzymes [BR:ppy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     PPE_03461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3776212..3777405
Genome map
AA seq 397 aa AA seqDB search
MKKKGLKKTFFVIASLVMGFTLYGYTPASADAASVKGYYHTQGNKIVDESGKEAAFNGLN
WFGLETPNYTLHGLWSRSMDDMLDQVKKEGYNLIRLPYSNQLFDSSSRPDSIDYHKNPDL
VGLTPIQIMDKLIEKAGQRGIQIILDRHRPGSGGQSELWYTSQYPESRWISDWKMLADRY
KNNPTVIGADLHNEPHGQASWGTGNTSTDWRLAAQRAGNAILSVNPNWLILVEGVDHNVQ
GNNSQYWWGGNLTGVANYPVVLDVPNRVVYSPHDYGPGVSSQPWFNDPAFPSNLPAIWDQ
TWGYISKQNIAPVLVGEFGGRNVDLSTTEGKWQNALVDYIGANNLYFTYWSLNPNSGDTG
GLLLDDWVTWNRPKQDMLSRIMKPVVFVAEQAKANAE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaaaggactgaaaaaaacatttttcgtcattgcctccctcgtaatgggcttc
acactgtatggctatactcccgcttcagcagatgcagccagtgtgaaaggatattatcac
acccaaggaaacaaaattgtagacgaatccgggaaagaagcggcatttaacggcctgaac
tggttcggtctggaaacccctaattataccttgcatggactgtggagccgctcaatggac
gacatgctagatcaggtgaagaaagaaggctacaatctgattcgtctgccttacagcaat
cagttattcgattccagttcccgtccagacagtattgattaccacaaaaaccctgatctg
gtcggattaactccgattcaaattatggacaagctgatcgaaaaagctggacaacgcggt
attcagattatccttgaccgtcaccgtccaggctcaggtgggcaatccgagctgtggtac
acatcccagtaccctgagtctcgctggattagtgactggaaaatgttagctgatcgttat
aaaaacaacccaaccgtcattggtgcggatttgcacaacgagccacacggtcaagcaagc
tggggtacaggcaatacctccacagactggcgtctggcggcacaacgtgcagggaatgcg
attctgtccgtgaatccgaattggctgattctcgtagaaggtgtagaccacaatgtacaa
ggcaacaatagccaatactggtggggtggcaacctcacaggtgtagccaactatcctgtc
gttctggacgtaccgaatcgtgtcgtatattctccacatgattacggcccaggtgtgtct
tcgcagccatggttcaacgacccggccttcccgtccaacctgcctgcgatctgggatcaa
acctggggctacatcagcaaacaaaacatagctccggtactggtcggtgaattcggcggt
cgtaatgttgatttgtctactactgaggggaaatggcaaaatgcactcgtagactacatt
ggtgccaacaacctgtactttacgtactggtccctgaatccgaatagcggcgacacaggc
ggtctgctgctggatgactgggttacctggaatcgtccgaagcaggatatgctcagccgg
attatgaagcctgttgttttcgtagcggaacaagcgaaagcaaacgccgaatag

DBGET integrated database retrieval system