KEGG   Paenibacillus polymyxa E681: PPE_03677Help
Entry
PPE_03677         CDS       T01319                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PPE_03677
Enzymes [BR:ppy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     PPE_03677
Exosome [BR:ppy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PPE_03677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4014628..4015626)
Genome map
AA seq 332 aa AA seqDB search
MNVPFTRHRRLRQSAAIRSMVRETVLNPADFIQPIYVTFGTGVKQEISSMPGVYRFSLDR
LEEELKEISELGIPAVLLFGIPETKDSVGTSAFVDDGIVQEATRLIKSRYPELLVVADTC
LCEFTDHGHCGMVHMHEHDGEVCGEVLNDESLEVLVRTAVSQARAGADIIAPSNMMDGFV
QAIRQGLDLEGFSHIPIMSYSVKYASAFYGPFREAADSAPQFGDRKSYQMDPANAREALR
EAESDVLEGADMLLVKPSLSYLDVMRTIKDQFDLPMVAYNVSGEYAMVKAAALQGWIDEK
AMVLEILTSMKRAGADMIITYSAKDAARWLKQ
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttccttttactagacatcgtcgtttgcgccagtcagctgcaatccgcagtatg
gtgcgtgagacggtattgaatcccgctgattttatccaaccgatttacgtaacatttggc
actggagtgaaacaggaaattagctctatgccaggtgtataccgtttttctctggatcgg
ctggaggaagaactgaaagagattagtgagcttggcattcccgctgtgctcctgtttggc
ataccggaaacaaaagacagtgtagggacttcggcttttgtggacgatggtattgttcag
gaagcgactcgtttgatcaagtctcgttatcccgaactgctggttgtggctgatacttgt
ttgtgtgagtttacggaccatggacactgcggtatggtacacatgcatgagcatgatggt
gaggtatgcggtgaagtattgaatgatgaatctctggaggtgctggtacgtacagccgtt
tctcaggccagagctggtgcggatattatcgcgccatctaatatgatggacggttttgta
caggcgattcggcaggggctggatttagaaggcttttcacatattccgattatgtcgtat
tccgtcaaatatgcgtctgctttttatggtcctttccgggaagctgctgattctgcaccg
cagtttggtgaccgtaaatcctatcagatggatcctgctaatgcacgtgaagcattgcga
gaagcggaatctgatgtgctggagggtgcggatatgctgctggtgaagccttctctttct
tacctggacgtgatgcgcacgattaaggatcaatttgatctgcctatggtggcttacaac
gttagtggtgaatatgccatggtcaaggcagcagctcttcaaggctggattgatgaaaaa
gcaatggtgctagagattttgacaagcatgaagcgtgcgggggcagatatgattattacc
tattcggccaaggatgcggcaagatggttgaagcaataa

DBGET integrated database retrieval system