KEGG   Paenibacillus polymyxa E681: PPE_03701Help
Entry
PPE_03701         CDS       T01319                                 

Gene name
glpK1
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ppy00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4044386..4045879)
Genome map
AA seq 497 aa AA seqDB search
MGKYILSLDQGTTSSRAILFNSEGDVVYSAQREFPQYFPHPGWVEQNANEIWSSILGVIA
SCLSESGVKANQVAAIGITNQRESVAVWDKNTGVPVYNVLVWQSRQTSDICEELKRQGHE
ELFHSKTGLLIDPYFSGTKVKWILDHVEGAREKAERGDLLFGTIDSWLIWKLSGGTAHVT
DYSNAARTLMYNIYELKWDEELLDILGVPKIMLPEVRPSSEVYAHTVDYHFFGQNVPIAG
AAGDQQAALFGQACYEKGMIKNTYGTGCFMLMNTGDQPVESKHGLITTIAWGLEEGKVQY
ALEGSVFVAGSAIQWLRDGLRMFREAKDSEPYAARVSSTEGVYLVPAFVGLGSPYWDSEV
RGAMFGLTRGTTKEHFIRATLESLAYQTKDVLTAMEIDSGIAVKTLRVDGGAVLNNFLMQ
FQSDILDATVERPVIHETTALGAACLAGLAIGYWKSTDELRKRVRVETSFAPNMDESTRE
SLYEGWKKAVNATMAYK
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaatatattttgtcactagatcagggaacgacaagctcaagagcgattttgttc
aatagcgaaggagatgtagtgtactcggctcagcgagaatttccgcaatattttcctcat
cccggctgggtagagcaaaatgcgaatgaaatctggagttctattctcggagtcattgcc
tcctgtctttccgaatccggtgtaaaagcaaatcaagtggctgccatcggcattaccaat
cagcgagagtcggtggctgtgtgggacaaaaatacaggagtgcccgtgtataacgtactc
gtatggcaatcacgccaaacctcggacatctgtgaagaattgaagcggcaagggcacgag
gagctttttcacagcaaaacaggcctgttgatcgacccgtatttttcaggcactaaagta
aagtggatactggaccatgtggagggcgcgcgggaaaaggcagaacgaggtgacctgtta
ttcggtacgattgactcgtggctgatctggaaactatccggcggaacggcacatgtaaca
gactactccaatgcagccaggacgctgatgtacaacatttatgaactaaagtgggacgaa
gagctgctggacattctgggtgttccgaaaatcatgctacctgaggtaagaccttcttcc
gaggtatatgcgcacaccgtggattatcatttctttggtcagaatgtaccaatcgccggt
gcagcaggtgaccagcaggcagccttgtttggtcaggcatgttacgaaaaagggatgatc
aaaaatacttacggcacaggctgctttatgctgatgaatacgggggatcagcctgttgaa
tccaagcacggtctgattacgaccatcgcttggggactggaggaaggcaaagtacaatat
gcactcgaggggagtgtgtttgtagcggggtcggcgatccagtggctgcgagacgggctg
cgtatgttccgtgaagcgaaggacagtgagccttatgccgcccgtgtttcgtctacagaa
ggagtgtatcttgtacccgcttttgttggactgggcagcccctactgggatagcgaggtg
cgcggagcgatgttcggcctgacacgcgggaccacgaaggagcattttatccgcgccaca
ttggagtcactcgcttatcagaccaaggatgtgcttacagccatggagattgattcaggt
attgcagtgaagacgctgcgggtggatggaggagctgtattgaacaattttctgatgcaa
ttccaaagcgatattttggatgcaacagtggagcggccagttatccatgagacgacggca
ctgggggctgcatgtctggcaggtttggctattggatattggaagagcacggatgaactt
cgcaagcgggtgagggtggaaacctcttttgccccgaatatggatgaatcaacacgtgaa
agcttgtatgaaggctggaaaaaggctgtgaatgcgacgatggcctacaagtaa

DBGET integrated database retrieval system