KEGG   Paenibacillus polymyxa E681: PPE_04396Help
Entry
PPE_04396         CDS       T01319                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
ppy00440  Phosphonate and phosphinate metabolism
ppy01100  Metabolic pathways
ppy01120  Microbial metabolism in diverse environments
ppy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    PPE_04396
Enzymes [BR:ppy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     PPE_04396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 NTP_transferase ICL DUF4533
Motif
Other DBs
NCBI-ProteinID: ADM72156
UniProt: E0RHM5
Position
complement(4812930..4814528)
Genome map
AA seq 532 aa AA seqDB search
MRKTQLLKQMITSSKLDFIMEAHNGISAKIVEEAGFQGIWGSGLTISASLGVRDNNEASW
TQILDVMEFMNDATRLPILLDGDTGYGNFNNMRRLVRKLEQRGVAGVCIEDKLFPKTNSF
ISGETQPLADMDEFCGKIQAAKETQSDDDFCVVARLESFIAGWGLDEALRRAEAYRLAGA
DAILVHSKKADSSDIEAFMREWGNRHPVVIVPTKYYSTPSDRFRELGINMVIWANHTLRS
AIHSMQQTVRQIYKDQSLINVEGKITTVSEIFKLQGADELKEAEKKYLPTSGKNVNALIL
AASQGNLGELTREIPKTLLKVSGKPILSMQVDDLNKVGIKDISVVRGFAKENVKLNNIST
IDNDQFASTQELYSLYLAKDKIGSDTTVISYGDIIYKNYILNDLLNDTNDITIVVDADAE
VSGNNQDLVVTEKPYSKNLYSSAVKLVSVSKSGVEQKFNGEFIGLWKVSAQGADIVKTVL
ERLSKEKDFHTLTLTDLFNELVKIHSVAVRFIKGDWLDVDTIVDLQKAGEML
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaacacagttgcttaaacaaatgattacaagttccaaacttgatttcattatg
gaggctcataatgggatatcagcgaaaattgtggaggaagcgggttttcaaggaatttgg
ggtagtggacttacgatctctgcttctctgggtgttcgtgataataacgaagcatcttgg
acacaaatcctcgatgttatggaatttatgaacgatgcgacgaggctgcctatactgcta
gatggagataccggttacggtaactttaacaatatgagaagattggtcagaaagcttgaa
cagcgtggtgtggctggtgtatgcattgaggataaactgtttcctaagacaaattctttc
atatctggagaaacacaaccgcttgcggatatggatgaattctgcggtaagatacaagct
gccaaggaaacgcaaagtgacgatgacttctgtgtagttgcgcgtttggaatcctttatt
gctggatgggggctggacgaagctttacgccgagcggaagcatatagattggcgggagcg
gacgccatactggttcatagtaaaaaagctgacagttctgatatcgaggctttcatgcga
gagtggggtaatcgtcatccagttgtgattgtgcctactaaatattattctacgccttcc
gatcggttcagggaacttggaattaacatggttatttgggcgaatcatactttacggtca
gctatccattctatgcaacagacagtgcggcagatttacaaagatcaatctttgattaac
gtagaaggtaaaattacaactgtgtctgaaatttttaagttacagggtgcggatgaactg
aaagaagcagagaaaaaatacctgcctacatccggaaaaaatgtaaatgcgctcattctt
gcggcgagtcaaggaaacttgggagaactcacaagagaaattcctaaaacactgctgaaa
gttagcgggaagccgatcctgagcatgcaagtggatgatctgaacaaggttggtataaag
gatatttcagtcgtacgcggatttgcaaaagagaacgtgaagctgaataatatttcgact
attgacaatgatcaatttgcttcaacccaagaactgtactctctttatctggccaaagat
aagattggtagtgatactacggtgattagctatggagatattatttataagaattacata
cttaatgatcttcttaacgatacaaacgatattacaattgtggtcgatgcggatgctgaa
gtttctggaaataatcaagatcttgttgtgactgaaaaaccttattccaaaaacttgtac
tctagcgccgttaagctagtaagtgtaagtaaatccggtgttgaacaaaaattcaatggt
gagtttatcgggctttggaaggtatccgcacaaggagcagatatagtaaaaacagtgctg
gaacgcttatctaaagaaaaagactttcatactcttactctgaccgatctatttaatgaa
ctagttaagatacattctgttgcagtgagatttattaaaggagattggctagatgtggac
acaattgtcgatcttcaaaaagcaggtgaaatgctgtga

DBGET integrated database retrieval system