KEGG   Paenibacillus polymyxa E681: PPE_04550Help
Entry
PPE_04550         CDS       T01319                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ppy00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4975874..4976725)
Genome map
AA seq 283 aa AA seqDB search
MAQRMAGKRVALAGPRKAEEMALLVVKMGGEPVQRPAQGTVFLDDIELRNAVVAWVKHPP
DWYIFTTGMGLDALFDMAEDMGVAEQIMELLQSSNIAARGYKTVNGLKKRGFTPAVRDED
GSLIGLTGAFAPYDLKGKEVLLQLHGDPAPRLVKWLDEQGAVTRQVLPYKHIPPEEAKLQ
ALLEDVIHRNVDAVTFTSGPQIRFLAQYAREQNRIEDLLEAFREDVIAVSVGKVTAQSIV
EEGIDRVVFPTEERMGAMMVELGKYFEHNDSVHGCGLKIVNGH
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggcacaacgcatggcaggtaagagagtcgctcttgctggtccccgtaaagcagaagaa
atggcgctgctagttgtgaagatggggggtgagccagtacagcgcccggcccagggcacc
gtttttttggatgatatcgagctgcgcaacgctgttgtagcgtgggtgaagcaccctccg
gactggtacatcttcacgacaggtatggggctggatgccttgttcgatatggcagaggat
atgggcgtggccgagcagattatggagttactgcaatcctccaacattgcagcgcggggc
tacaagactgtcaatggactcaaaaagcgtggctttacgccagcagtacgagacgaggac
ggaagtttgatcggattgacaggagctttcgccccatacgatctgaaggggaaggaagta
ttgttgcaactgcatggtgatccagctccacggttggtaaagtggctggacgagcagggg
gcagtgacccgccaggtacttccttataagcatatcccacctgaggaagcaaaattgcag
gcgttactggaggatgttatccatcgtaatgttgatgctgttacgttcacaagtggtccg
caaatccgatttttggcccaatatgccagagagcaaaatcgaatcgaggatttactggaa
gcctttcgtgaggatgtgattgctgtatccgtagggaaggtgactgcacagtccattgtg
gaagaagggattgatcgagtcgtgtttccaaccgaagagcgcatgggcgcgatgatggtg
gagctgggcaaatattttgaacataacgattcggtgcatggatgtggtctgaagatcgtg
aatggtcattga

DBGET integrated database retrieval system