KEGG   Paenibacillus polymyxa E681: PPE_04664Help
Entry
PPE_04664         CDS       T01319                                 

Definition
2,3-bisphosphoglycerate-independent phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PPE_04664
   01230 Biosynthesis of amino acids
    PPE_04664
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPE_04664
  Energy metabolism
   00680 Methane metabolism
    PPE_04664
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PPE_04664
Enzymes [BR:ppy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PPE_04664
Exosome [BR:ppy04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PPE_04664
  Exosomal proteins of melanoma cells
   PPE_04664
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5097763..5098512)
Genome map
AA seq 249 aa AA seqDB search
MYQVVLVRHGQSVYNRQNLFTGWTDVDLTEQGTHEAIEAGRILKEAGYTFDLAFASVLKR
SIRTLYHILDELDHLWIPVQKSWKLNERHYGALQGLSKLDSAVQYGEEQVHIWRRSLTVR
PPMLDEKDERSPHREERYRNIKPEELPLGESLEDTVHRVGEFWKQRIVPLILKKDRVIIS
AHGNTLRALIKYMENLDETALLDLNIPTGIPLVYELDEHIDPIRRFYLGDPSHVEAKKQA
VANQSKVTE
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtatcaagtggtgctggttaggcatggacagagcgtgtataaccgacaaaacctgttt
acgggctggacggacgtggacctgactgaacaagggactcatgaggccattgaggcggga
cgtattctcaaggaggctggttatacgtttgatttggcatttgcctctgtgctaaaacga
tctatccgcacgctgtatcacatcttggatgagctggatcatctgtggatacctgtgcag
aagtcatggaagctgaatgaacgccattacggtgctcttcaagggcttagcaagctggat
tccgccgtgcaatacggcgaggagcaagttcatatctggcggcgtagtctgacggtgcgg
ccccccatgttggatgagaaggacgagcggagtccgcatcgggaagagcgttatcgcaat
attaagccagaagagctgccgcttggggaaagtctggaggacacagtgcatcgggtcggt
gagttttggaagcagcggattgtacctttgattctcaaaaaggatcgagttattatttct
gcacatggtaatactttaagggccttaatcaagtatatggagaatctggatgaaaccgca
ttgctggatttgaatattccgacaggcattccactggtgtacgagctggatgaacatata
gatcccatccggcgcttttatctcggtgatccgagtcatgtagaggcaaagaaacaggct
gtggccaatcaaagcaaggtaacggagtga

DBGET integrated database retrieval system