KEGG   Paenibacillus polymyxa E681: PPE_04664Help
Entry
PPE_04664         CDS       T01319                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
ppy00010  Glycolysis / Gluconeogenesis
ppy00260  Glycine, serine and threonine metabolism
ppy00680  Methane metabolism
ppy01100  Metabolic pathways
ppy01110  Biosynthesis of secondary metabolites
ppy01120  Microbial metabolism in diverse environments
ppy01130  Biosynthesis of antibiotics
ppy01200  Carbon metabolism
ppy01230  Biosynthesis of amino acids
Module
ppy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ppy_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPE_04664 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    PPE_04664 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PPE_04664 (gpmA)
Enzymes [BR:ppy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PPE_04664 (gpmA)
Membrane trafficking [BR:ppy04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    PPE_04664 (gpmA)
Exosome [BR:ppy04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PPE_04664 (gpmA)
  Exosomal proteins of melanoma cells
   PPE_04664 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TAF6_C
Motif
Other DBs
NCBI-ProteinID: ADM72423
UniProt: E0RKY6
Position
complement(5097763..5098512)
Genome map
AA seq 249 aa AA seqDB search
MYQVVLVRHGQSVYNRQNLFTGWTDVDLTEQGTHEAIEAGRILKEAGYTFDLAFASVLKR
SIRTLYHILDELDHLWIPVQKSWKLNERHYGALQGLSKLDSAVQYGEEQVHIWRRSLTVR
PPMLDEKDERSPHREERYRNIKPEELPLGESLEDTVHRVGEFWKQRIVPLILKKDRVIIS
AHGNTLRALIKYMENLDETALLDLNIPTGIPLVYELDEHIDPIRRFYLGDPSHVEAKKQA
VANQSKVTE
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtatcaagtggtgctggttaggcatggacagagcgtgtataaccgacaaaacctgttt
acgggctggacggacgtggacctgactgaacaagggactcatgaggccattgaggcggga
cgtattctcaaggaggctggttatacgtttgatttggcatttgcctctgtgctaaaacga
tctatccgcacgctgtatcacatcttggatgagctggatcatctgtggatacctgtgcag
aagtcatggaagctgaatgaacgccattacggtgctcttcaagggcttagcaagctggat
tccgccgtgcaatacggcgaggagcaagttcatatctggcggcgtagtctgacggtgcgg
ccccccatgttggatgagaaggacgagcggagtccgcatcgggaagagcgttatcgcaat
attaagccagaagagctgccgcttggggaaagtctggaggacacagtgcatcgggtcggt
gagttttggaagcagcggattgtacctttgattctcaaaaaggatcgagttattatttct
gcacatggtaatactttaagggccttaatcaagtatatggagaatctggatgaaaccgca
ttgctggatttgaatattccgacaggcattccactggtgtacgagctggatgaacatata
gatcccatccggcgcttttatctcggtgatccgagtcatgtagaggcaaagaaacaggct
gtggccaatcaaagcaaggtaacggagtga

DBGET integrated database retrieval system