KEGG   Paenibacillus polymyxa E681: PPE_04833Help
Entry
PPE_04833         CDS       T01319                                 

Definition
beta-1,4-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ppy  Paenibacillus polymyxa E681
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5280888..5281844)
Genome map
AA seq 318 aa AA seqDB search
MSKFKVGKLVSSLALAGMLLSSALINPASASMANGGKFLGNIIAGSVPASFGTYWNQVTP
ENSTKWGSVEGSRNNMNWSQADTAYNYARNNGFPFKFHTLVWGAQEPGWISGLSAADQKA
EVTQWIKAAGQRYPNAEFIDVVNEPLHQKPSFRNAIGGDGSTGWDWVIWSFQQARQAFPN
AKLLINEYGIINDPSLTDQYVNIINQLKSRGLIDGIGIQCHQFSMDTVSVNTMNTVLNKL
AATGLPIYVSELDITGDDNTQLARYKEKFPVLWKHSAVKGVTLWGYIQGQTWISNTHLLN
SNGTERPALQWLRQYVQS
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaatttaaagtgggcaagttggtaagcagcttggcgttggcgggtatgttgtta
tcatcagctctgataaacccggccagtgccagtatggcgaacggtggtaaattcctcggg
aatatcattgctggaagtgtccctgcaagtttcggaacgtactggaaccaggtgacgcca
gagaattcgaccaaatgggggtcagttgaaggcagccgtaacaacatgaactggtcgcag
gcggataccgcctacaattatgcccgtaacaatggatttccgttcaagttccatacattg
gtatggggtgctcaggagccaggttggattagcggactgtcggctgctgatcagaaggcg
gaagtgacccagtggattaaagcagcaggtcaacgctatccgaatgcggagtttatagat
gtggtgaatgagcccctgcatcagaagccatccttccgcaatgccataggcggtgacgga
tcgactggatgggattgggttatatggtcgttccaacaggccagacaagctttcccgaat
gccaagctactgatcaatgaatatggaataatcaacgatccctcgttaaccgaccaatat
gtcaatattattaatcagctcaagagcagaggcctgattgacggaattggtattcaatgc
caccagtttagcatggacactgtttcagttaacacgatgaacactgtactgaacaagctg
gcggcaacaggattgccaatctatgtgtcggaactggatataactggcgacgacaatacc
cagcttgccagatacaaggagaaatttccggtattatggaagcattccgcggtgaaggga
gttacgctctggggatacatccaggggcagacctggatatctaatacacatctgctgaac
tcgaatggcacggaacgtcccgcactccaatggctgagacaatatgtgcagagttaa

DBGET integrated database retrieval system