KEGG   Pseudomonas poae: H045_02015Help
Entry
H045_02015        CDS       T02456                                 

Definition
hypothetical protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
ppz  Pseudomonas poae
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ppz01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ppz00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
437871..438698
Genome map
AA seq 275 aa AA seqDB search
MIDLIVSQGRVADKTARTVVGAVRTAIALEQRYQIKGNAVGKAAPAATDDWSVSLPQARE
NLIDLGAAVSASIKRGNLTILASNTCPASIATLPVVAREYPDAVVLWIDAHGDFNTPETT
DTGYLGGMVVSAACGLWDSGHGAGLRPEQVILIGARDVDRSERELLNRAGVRIIPPAQVT
PQTVLNAINGAQVWVHIDWDVLEPGFVPADYQVPDGVFPAQLRALFEAIPLKQILGIELA
EFNAPTDDASNNKALSIILDIVAPVFEKLAAERTL
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgattgaccttatcgtttctcagggccgtgtcgctgacaagacggcacgcacggtagtg
ggcgccgtccgcacggcaatagcattagaacagcgttaccaaatcaagggcaatgcggtt
ggaaaagcggctccagctgctactgacgattggagcgttagtcttccccaggcgagggag
aacctaatcgatttgggggcagcggtctctgcgagcatcaagcgggggaaccttacaatc
ctggcgtctaacacctgcccggcaagcatcgccacacttcctgttgtagcgcgtgagtac
ccggacgctgtagtgctctggatcgacgcacacggtgacttcaatacgcccgaaacgact
gatacaggctacctaggcggcatggtggtttccgctgcgtgtggactctgggacagcggt
catggtgctgggcttcgccctgagcaagtgatcctgatcggggcaagagacgtagaccga
agcgagcgcgaactgctcaacagagcaggggtgcggatcattcccccggcgcaagtaacg
ccgcaaacagtattgaatgccattaacggcgcgcaagtctgggtgcatatcgattgggat
gtactcgaacccggcttcgtgcccgccgattaccaagtccctgacggtgtattcccggca
caacttcgggcgctgtttgaggctattccgttgaagcaaattctgggcatcgaactggcc
gaatttaatgcacctactgacgatgccagcaataacaaggcgctttcaatcattctcgat
atcgtagctccggtcttcgaaaagttggcggccgagcgcaccctttaa

DBGET integrated database retrieval system