KEGG   Pseudomonas poae: H045_02015Help
Entry
H045_02015        CDS       T02456                                 

Definition
(GenBank) hypothetical protein
  KO
K01476  arginase [EC:3.5.3.1]
Organism
ppz  Pseudomonas poae
Pathway
ppz00220  Arginine biosynthesis
ppz00330  Arginine and proline metabolism
ppz01100  Metabolic pathways
ppz01110  Biosynthesis of secondary metabolites
ppz01130  Biosynthesis of antibiotics
ppz01230  Biosynthesis of amino acids
Module
ppz_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:ppz00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    H045_02015
   00330 Arginine and proline metabolism
    H045_02015
Enzymes [BR:ppz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     H045_02015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase DUF2990
Motif
Other DBs
NCBI-ProteinID: AGE24479
Position
437871..438698
Genome map
AA seq 275 aa AA seqDB search
MIDLIVSQGRVADKTARTVVGAVRTAIALEQRYQIKGNAVGKAAPAATDDWSVSLPQARE
NLIDLGAAVSASIKRGNLTILASNTCPASIATLPVVAREYPDAVVLWIDAHGDFNTPETT
DTGYLGGMVVSAACGLWDSGHGAGLRPEQVILIGARDVDRSERELLNRAGVRIIPPAQVT
PQTVLNAINGAQVWVHIDWDVLEPGFVPADYQVPDGVFPAQLRALFEAIPLKQILGIELA
EFNAPTDDASNNKALSIILDIVAPVFEKLAAERTL
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgattgaccttatcgtttctcagggccgtgtcgctgacaagacggcacgcacggtagtg
ggcgccgtccgcacggcaatagcattagaacagcgttaccaaatcaagggcaatgcggtt
ggaaaagcggctccagctgctactgacgattggagcgttagtcttccccaggcgagggag
aacctaatcgatttgggggcagcggtctctgcgagcatcaagcgggggaaccttacaatc
ctggcgtctaacacctgcccggcaagcatcgccacacttcctgttgtagcgcgtgagtac
ccggacgctgtagtgctctggatcgacgcacacggtgacttcaatacgcccgaaacgact
gatacaggctacctaggcggcatggtggtttccgctgcgtgtggactctgggacagcggt
catggtgctgggcttcgccctgagcaagtgatcctgatcggggcaagagacgtagaccga
agcgagcgcgaactgctcaacagagcaggggtgcggatcattcccccggcgcaagtaacg
ccgcaaacagtattgaatgccattaacggcgcgcaagtctgggtgcatatcgattgggat
gtactcgaacccggcttcgtgcccgccgattaccaagtccctgacggtgtattcccggca
caacttcgggcgctgtttgaggctattccgttgaagcaaattctgggcatcgaactggcc
gaatttaatgcacctactgacgatgccagcaataacaaggcgctttcaatcattctcgat
atcgtagctccggtcttcgaaaagttggcggccgagcgcaccctttaa

DBGET integrated database retrieval system