KEGG   Pseudomonas poae: H045_02540Help
Entry
H045_02540        CDS       T02456                                 

Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
ppz  Pseudomonas poae
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
560163..561056
Genome map
AA seq 297 aa AA seqDB search
MNGAEIDLGEGTAGFVLGEGPVGILLIHGLTGTPTELRQVAKGLVKAGNCTVYVPTLAGH
CGDNSDLQATGWRDWYEGVRKAFVQIKQRHAQVFVGGLSMGAVMSMYVAAEHPGQVAGLL
MYSTTLKYDGWSISKLAFLSPLLMKIPFGVHVCRFEEKPPYGIKNERLRAVVERQMKEGE
SSEAGLLTMEGITVRELHRMNAVVKKRMREVKVPALVLHSIEDDITSRWNADYVERHLGG
PVTKILLDNCYHMITVDLQYRRVIELSARFVEQHTSTNTTLVNVGAGLPAIASLRSA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtgaacggcgcagagatcgacctcggcgaaggtactgccggcttcgttctcggtgaaggt
ccggtcgggatcctgttgatccacggcctgaccggcaccccgacggaattgcgccaggtc
gccaaggggctggtcaaggcaggcaactgcacggtgtacgtgccgaccctggccgggcac
tgcggtgacaacagcgacctgcaggccaccggctggcgtgactggtacgaaggcgtgcgc
aaggccttcgtacaaatcaaacagcgccatgcacaggtatttgtcggcggcctgtccatg
ggcgcggtgatgtcgatgtacgtcgccgctgagcaccctgggcaggtggccgggttgttg
atgtattccacgaccctgaagtacgacggctggagcatcagcaagctggcgtttctgtcg
ccgttgctgatgaagattccgttcggcgtgcatgtctgccgcttcgaagaaaagccgccc
tacggcatcaagaacgagcgcctgcgggctgtcgtcgaacgccagatgaaagaaggggag
agcagcgaggccggcctgttgaccatggagggcatcacggtgcgcgagttgcaccgcatg
aacgccgtggtcaaaaaacgcatgcgcgaagtcaaggtgccggcgctggtgctgcattcc
atcgaggacgacatcaccagccgctggaacgccgactacgtggagcgtcacctcggcggc
ccggtgaccaagatcctgctggacaactgctaccacatgatcaccgtcgacctgcaatac
cggcgggtgatcgagttgagtgcccggttcgttgagcaacacacgtcgacaaacaccacc
ttggtcaatgtgggagctggcttgcctgcgattgcctcactgcggtccgcctga

DBGET integrated database retrieval system