KEGG   Pseudomonas poae: H045_07025Help
Entry
H045_07025        CDS       T02456                                 

Definition
magnesium chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
ppz  Pseudomonas poae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ppz00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1530464..1531462
Genome map
AA seq 332 aa AA seqDB search
MTDIPHFPLSAVVGADALKLALCLAAIDPKIGGVLIEGPRGMAKSTLARGLADLLASGQF
VTLPLGATEERLVGTLDLDAALGEGRAQFSPGVLAKADGGVLYVDEVNLLPDHLVDLLLD
VAASGTNLIERDGISHRHAARFVLIGTMNPEEGELRPQLLDRFGFNVALSGHTLPTERGQ
VIRRRLDFDSDPDAFCAQWAEPQAALRARCTQARERLELIAMDDDALAQITERCFAAGVD
GLRADLVWLRGARAHAAWRGADAIAEEDIQAVAEFALRHRRQEPSPPASPPNQGQSAQPS
DTSPGQGQWGDLPAPALPTGARREVPAWPKKP
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatattccacatttcccgctgtctgctgtcgtcggtgccgacgcgctgaaactc
gcactgtgcctggccgccatcgacccgaagattggcggcgtgctgatcgaaggtccgcgc
ggcatggccaagtccaccctggcccgtggcctggcggacctgctcgccagcgggcaattt
gtcaccttgcccctgggcgccaccgaagagcgactggtcggcaccctcgacctggatgcg
gcgctgggcgaaggccgtgcgcagttttcccccggcgtattggccaaggccgacggcggc
gtgttgtatgtagatgaagtcaatttgctgcccgaccatctggtcgacctgctgctggac
gtggccgccagcggcaccaacctgatcgagcgcgacggtatttcccaccggcacgcggcg
cgctttgtgttgattggcaccatgaacccggaggagggcgagttgcgcccgcagctgctc
gaccgcttcggcttcaatgtggcgctgagcggccacaccttgccgaccgagcgtgggcag
gtcatccgccgccgtctggatttcgacagcgaccctgatgctttctgtgcgcaatgggcc
gagccccaggccgccttgcgtgcgcgctgcacccaggcgcgcgagcggctcgagcttatt
gccatggatgacgatgcgctggcgcagatcaccgagcgctgttttgccgccggggtcgat
ggcctgcgcgccgacctggtctggttacgtggcgcccgtgcccacgcagcctggcgcggc
gccgatgccatcgccgaagaagacatccaggccgtggccgaatttgccctgcgtcatcgc
cgccaggagccatccccaccggcgagcccgcccaatcaaggtcagtccgcgcaaccatcg
gacacctcgccgggccagggccaatggggtgacctgcccgcaccggcactgcccaccggc
gcgcgccgcgaagtgcccgcctggccaaaaaagccctag

DBGET integrated database retrieval system