KEGG   Pseudomonas poae: H045_07425Help
Entry
H045_07425        CDS       T02456                                 

Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ppz  Pseudomonas poae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    H045_07425
Enzymes [BR:ppz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     H045_07425
Exosome [BR:ppz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   H045_07425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1636642..1638879
Genome map
AA seq 745 aa AA seqDB search
MSYINKEPLQPKLTAMPASSDVEALVRAEHPDPFSIMGPHDDEQGGQFIRAFLPEALSVQ
VLTRDGGESIGSLEATQVPGLFIGHFATRQDYLLKIQWAGGEQITEDPYSFSQLLLGEMD
LYLFAEGNHRDLGSCLGAQVTHVDGVQGVRFAVWAPNARRVSVVGDFNIWDGRRHPMRLR
HPSGVWEIFIPRLQPGAAYKYEILGAHGILPLKADPMALATQLPPDTASKVAPPLQVDWQ
DHDWMQSRTDKQKPSAPLSIYELHVGSWQCELDEAGEVSRQYGWRELAERLIPYVQELGF
THIELMPIMEHPFGGSWGYQALSQFAPSARFGSPEDFAYFVNALHQADIGVILDWVPAHF
PTDTHGLAQFDGTALYEYANPLEGFHQDWDTLIYNLGRTEVHGFMLASALHWLKHFHIDG
LRVDAVASMLYRDYSRKAGEWVPNRHGGRENLEAIEFLRHLNDVVALEAPGALVIAEEST
AWPGVSQPTQQGGLGFNYKWNMGWMHDSLHYIQQDPVYRAHHHNELSFGLVYAWSERFIL
PISHDEVVHGKHSLIDKMPGDRWQKFANLRAYLSFMWMHPGKKLLFMGCEFGQWREWNHD
QQLDWYLLQYPEHRGVQKLVGDLNRLYREEPALHDQDDAPQGFQWLIGDDAINSVFAWLR
WSKDGKPVLVVANFTPVPREGYTVGVPFAGRWSEVINSDADTYAGSNFGNGGGVFTQEEP
RHGQPVSLSLNLPPLGVLILRPELS
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgagttatatcaataaagaaccgctgcagcccaagttgacagcaatgccggcgtccagc
gacgtcgaagcgctggtgcgcgccgagcacccggacccgttttcgattatgggtccccat
gatgacgagcagggcgggcagttcattcgcgcgttcctgcccgaagccctgagtgtgcag
gtattgacacgggacggcggcgagtcgatcggcagcctggaggcgactcaggtgccgggc
ctgttcatcgggcactttgccacgcgtcaggattacctcttgaaaatccaatgggccggc
ggcgagcagatcaccgaagacccttacagtttcagccaactgctgctgggcgagatggac
ctgtacctgttcgccgaaggcaatcaccgcgacctcggcagctgcctgggcgctcaggtg
actcacgttgatggcgtgcagggcgtacggtttgccgtgtgggcgccaaacgcccgacgt
gtgtcggtggtgggcgacttcaatatctgggacggtcgccgtcacccgatgcgcctgcgg
cacccgtcgggcgtgtgggaaatcttcatcccgcgcctgcaaccgggggcggcctacaaa
tacgagattctcggcgcccatggcatcctgccgctcaaggccgatcccatggccctggcc
actcagctgccgcccgacacagcgtccaaagtggcgcccccgttgcaggtggattggcag
gaccatgactggatgcagtcgcgtacggacaagcagaaaccgtcggcgccgctgtcgatc
tacgagctgcatgtgggctcctggcagtgcgagctggacgaggcgggcgaggtgtcgcgc
cagtacggctggcgtgaactggccgagcggctgattccttacgtacaggagctgggcttt
acccatatcgagctgatgcccatcatggaacacccgtttggcggttcgtggggttaccag
gcgctgtcacagtttgcgccgagcgcgcgctttggctcgccggaagattttgcgtacttc
gtcaacgccctgcatcaggccgatatcggcgtgatcctcgattgggtgccggcgcatttc
ccgaccgacacccacggcctggcgcaatttgacggcaccgcgctgtacgaatacgccaac
ccgctggaaggtttccaccaggactgggacacgctgatctacaacctgggtcgcaccgaa
gtgcacgggttcatgctggcctcggcgttgcactggctcaagcatttccacatcgacggt
ctgcgtgtggatgcggtggcgtcaatgctgtaccgagactactcgcgcaaggccggtgaa
tgggtgcccaatcgtcacggcgggcgggaaaacctggaagccatcgaatttttgcgtcat
ttgaacgatgtggtggctctcgaagcgcccggtgcgctggtcatcgccgaagaatccacg
gcctggccgggcgtcagccagccgacccagcagggtggcctgggcttcaactacaagtgg
aatatgggctggatgcacgattcgctgcattacatccagcaggacccggtgtaccgcgcc
catcatcacaacgagctgagtttcggcctggtgtacgcctggtcagagcgcttcatcctg
ccgatctcccacgatgaagtggtgcacggcaagcattcgctgatcgacaagatgcccgga
gaccgctggcagaaattcgccaacctgcgcgcctacctgagtttcatgtggatgcatccc
ggcaagaagctgctgttcatgggctgtgagtttggccagtggcgcgaatggaaccacgat
cagcaactggactggtacttgctccagtaccccgaacaccggggcgtgcagaaactggtg
ggcgacttgaaccgcctgtaccgcgaggaaccggcgctgcacgatcaggacgatgcgccg
cagggctttcagtggctgattggcgacgacgccatcaacagcgtttttgcctggctgcgc
tggagcaaggacggcaagccggtgctggtggtggccaactttaccccggtgcctcgtgag
ggctacaccgtgggcgtgccgtttgccgggcgttggagcgaggtgatcaacagtgatgcg
gacacctacgcaggttccaacttcggtaatggcggtggcgtgttcactcaggaggagcca
cgtcatgggcaaccggtgtcgctgtccttgaatctgccaccgctgggcgtactgattttg
cgccctgagttgagttaa

DBGET integrated database retrieval system