KEGG   Pseudomonas poae: H045_07975Help
Entry
H045_07975        CDS       T02456                                 

Definition
glycosyl hydrolase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ppz  Pseudomonas poae
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1762446..1763552)
Genome map
AA seq 368 aa AA seqDB search
MKPFNRRRFLTMTLQAMALAPLLRVRPALADDTFRPLRAVAAQQRLSFGFAVDPVLLDTN
PSYRDVVARQAGIVVPENALKWAKVHPAPDRYTFAPVDLILAFAQANHQHMRGHTLCWHR
ALPDWVTRTVTPANAKEVLTQHIAEVVGRYRGKIVSWDVVNEAIQVDDGQAGGLRDAFWY
RMLGPGYIDLAYEAAHRADPDAALCYNEYGLESDSPAGTRKRAAVLALLRTLKQRGVPVD
ALGIQSHLRAADPHGFGPGLAAFLRQVHDLGLSVYITELDVDDSHMTGDANQRDAIVADT
YKRYLDLVLGTGTVSAVLTWGVWDTAHRTGATPSMGPLAQRPLVFGPQGVIKPASWAVEH
SLAWNRYP
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaagccatttaatcgccgacgcttcctcactatgacgttgcaggccatggccctcgcg
ccgcttttgcgtgttcgccccgcgcttgccgacgacacctttcgacccttgcgcgcagtc
gctgcgcaacaacggctctcgttcggcttcgcggtagatcccgtcctgctcgataccaac
ccgtcgtatcgggacgtcgtggcccggcaagcaggcatcgtggtgccggaaaacgcgttg
aaatgggccaaggttcaccccgcgccggaccgctacaccttcgcacccgtggaccttatc
ctcgcatttgcgcaggcgaaccatcagcacatgcgcggccacacactgtgctggcaccgc
gccctgcccgactgggtcacccgcacggtcacacccgctaatgcaaaggaggtactgacg
caacacattgccgaggtggtaggccgctaccggggcaagattgtctcttgggatgtcgtc
aacgaggccattcaagttgacgacgggcaggcaggcgggctgcgcgacgccttctggtac
cggatgctcggtcccggctatatcgacctggcctacgaggccgcgcaccgtgccgatccg
gacgccgcactctgctacaacgaatacggactggaaagcgactcacccgctggcacgcgc
aagcgcgccgccgtgcttgccctcctgcggaccctgaagcagcgcggcgtgccggtggat
gcgctgggcattcagtcccatctgcgcgctgcggacccgcatggcttcggccccgggctc
gccgcgttcctgcggcaggtacatgacctgggcctcagtgtctacattaccgaactcgac
gtcgacgacagccacatgacgggtgacgcgaatcaacgcgacgccatcgtggccgatacc
tacaagcgatacctggacctcgtgctcggcacgggcacggtatccgccgttttgacctgg
ggtgtatgggataccgcgcaccgcaccggtgctaccccttcgatgggaccactggcgcag
cgaccgctggtgttcggaccgcagggcgtaatcaaacccgccagttgggccgtcgagcat
agcctggcatggaatcgctatccatga

DBGET integrated database retrieval system