KEGG   Pseudomonas poae: H045_08580Help
Entry
H045_08580        CDS       T02456                                 

Definition
protein-glutamate methylesterase, CheB family
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ppz  Pseudomonas poae
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:ppz00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    H045_08580
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    H045_08580
Enzymes [BR:ppz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     H045_08580
Two-component system [BR:ppz02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   H045_08580
Bacterial motility proteins [BR:ppz02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    H045_08580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1908152..1908751
Genome map
AA seq 199 aa AA seqDB search
MNDAAANPIRGIEAIVVGASAGGVEALLSIFGELPTDFGLPIVAVLHLPDERRSQLADVF
ARRLRIPVKEARDKELIEAGTLYFAGPGYHLSVEQDRSLSLSQEDRVHHSRPAIDYLFSS
AADAYGAGLLAILLTGANQDGARGLAHVKQSGGTTVVQDPTEARIAVMPLAALALHTPDH
ILTLGRIGSLLASLESSPC
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgccgcagccaacccgattcgcgggattgaagccatcgtcgtcggcgcgtcc
gccggcggtgtcgaggcgttgctgagcatatttggcgagttgcccaccgacttcggcctg
ccgatcgttgctgtgctgcacctgccggacgagcgccgcagccagttggccgacgtgttc
gcgcggcgcctgcgcatcccggtaaaagaagcgcgggacaaagagctgatcgaggccggc
accctgtatttcgccgggcccggttaccacctctcggtggagcaggaccgcagcctgtcc
ctgagccaggaagaccgcgtgcatcattcacggccagccatcgattatctgttttcatcg
gctgccgatgcgtacggcgccggcctgctggcgatcctgctcaccggcgccaatcaggac
ggcgcgcgcgggctggcacatgtcaagcaatcgggcggcaccacggtcgtgcaggacccc
acggaagctcgcatcgccgtgatgccgctggcggccctggccctgcacacacctgatcat
attctgacactgggccggatcggctcattgctggcttccctggaatcttccccatgttaa

DBGET integrated database retrieval system