KEGG   Pseudomonas poae: H045_08580Help
Entry
H045_08580        CDS       T02456                                 

Definition
protein-glutamate methylesterase, CheB family
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ppz  Pseudomonas poae
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:ppz02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:ppz02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1908152..1908751
Genome map
AA seq 199 aa AA seqDB search
MNDAAANPIRGIEAIVVGASAGGVEALLSIFGELPTDFGLPIVAVLHLPDERRSQLADVF
ARRLRIPVKEARDKELIEAGTLYFAGPGYHLSVEQDRSLSLSQEDRVHHSRPAIDYLFSS
AADAYGAGLLAILLTGANQDGARGLAHVKQSGGTTVVQDPTEARIAVMPLAALALHTPDH
ILTLGRIGSLLASLESSPC
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgccgcagccaacccgattcgcgggattgaagccatcgtcgtcggcgcgtcc
gccggcggtgtcgaggcgttgctgagcatatttggcgagttgcccaccgacttcggcctg
ccgatcgttgctgtgctgcacctgccggacgagcgccgcagccagttggccgacgtgttc
gcgcggcgcctgcgcatcccggtaaaagaagcgcgggacaaagagctgatcgaggccggc
accctgtatttcgccgggcccggttaccacctctcggtggagcaggaccgcagcctgtcc
ctgagccaggaagaccgcgtgcatcattcacggccagccatcgattatctgttttcatcg
gctgccgatgcgtacggcgccggcctgctggcgatcctgctcaccggcgccaatcaggac
ggcgcgcgcgggctggcacatgtcaagcaatcgggcggcaccacggtcgtgcaggacccc
acggaagctcgcatcgccgtgatgccgctggcggccctggccctgcacacacctgatcat
attctgacactgggccggatcggctcattgctggcttccctggaatcttccccatgttaa

DBGET integrated database retrieval system