KEGG   Pseudomonas poae: H045_08740Help
Entry
H045_08740        CDS       T02456                                 

Definition
carbohydrate kinase PfkB
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ppz  Pseudomonas poae
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ppz00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    H045_08740
Enzymes [BR:ppz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     H045_08740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1949604..1950524
Genome map
AA seq 306 aa AA seqDB search
MSKIAVIGSNMVDLITYIDRMPAQGETLEAPDFALGCGGKGANQAVAAAKLGSRVLMLSK
VGDDMFADNTLANFQRFGIDTRYVQRVPNVSSGVAPIFVRSDSHNSILIVKGANAHLAPA
DIDAAAAELRECALIVLQLEIRLETVYYAIEFARRHGIAVLLNPAPALAGLSPEHLAQLD
FLIPNESELALITGQVVDSPAAAQTAARTLVASGIRHVIVTLGEQGALYVGEEGEFRVPG
RQVAARDTTGAGDAFIGCFIHHWNRDGNIQQAMEQAVAYSACSVMALGTQSSYPNSEAFA
RFQQQP
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagatcgcagtcatcggcagcaacatggtggatttgattacctatatcgaccgc
atgccggcccagggcgaaaccctggaagcgccggacttcgccctcggttgcggtggcaag
ggcgccaaccaggcggtggcggctgccaagctcgggtcccgggtgttgatgttgagcaag
gttggcgacgacatgtttgccgacaacaccctggccaatttccagcgctttggtatcgac
acccgttatgtgcagcgggtgcctaacgtttccagtggtgtagcgccgatttttgtgcgc
tccgattcccacaacagcattctcatcgtcaagggcgccaacgcgcatctggcgccggca
gacattgatgcggccgcagccgagttgcgtgagtgcgcgctgatcgtgctgcaactggaa
atccgactggagacggtctactacgccatcgaattcgcgcgccggcacggcattgcggtg
ctgctcaacccggcaccggccctggcgggcttgagccctgagcatctggcgcaactggat
tttctgatccccaacgaatcggagctggcgctgatcaccgggcaggtggtggactcgccg
gctgccgctcaaaccgctgcgcgcacattggttgccagcggcattcgccacgtcattgtc
accctgggcgaacagggtgcgctgtacgtgggcgaggagggcgagttccgcgtgccaggc
cgccaggttgcggcccgtgacaccaccggcgccggtgatgccttcatcggttgcttcatt
caccactggaaccgcgacggcaatattcagcaggccatggagcaggcagtggcgtactcg
gcatgctcggtcatggcgctgggcacgcagtcttcctatcccaacagcgaagcgttcgcg
cgcttccagcaacagccgtaa

DBGET integrated database retrieval system