KEGG   Pseudomonas poae: H045_09310Help
Entry
H045_09310        CDS       T02456                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ppz  Pseudomonas poae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ppz00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2108768..2110852
Genome map
AA seq 694 aa AA seqDB search
MSEANLEILASRAGLAVDWIDANGRPQRVSADALRAVLKGLGHPADNDAEIDASLHELEQ
AQHDKHLPPLLTVESGDGLDLARFFAPDTPCRVNLEQGETLELRLDDNAVLPGVIALGYH
QVRIADQAFTLAVAPRHCYSVAEAVDTHPARAWGLSAQLYSLRRLGDGGFGDTQALENLV
RAAAERGADALAISPMHAMFSANTGSYSPYSPSSRLFLNSLYASPASILGEREVRDAIEA
LGLDEELHRLEQDTLIDWPAAANAKQRLLRALYEDFRHGHHPQHADFLSFRQAGGEALEN
HCRFEAVQAMRAAAGEDLDWRHWPEDWRTPQSPALAQFAEDNRDEIGFYAFSQWLIARCL
ARAQQAARGSGMGVGLIADLAVGADGGGSQAWSRQDELLADLTVGAPPDILNRAGQGWGI
SAFSPEGLKRNGFRAFIEMLRANFAHAGGLRIDHVMGLQRLWVIPMNASPREGAYLYFPV
DDMLRLLALESHRHQAIVLGEDLGTVPDGLREKLSSRSILGMRVLLFEQNHEGRFTPILD
WPDNALATTSTHDLPTLNGWWHSRDIDWNVQLGLIDAPTVEQWSEHRLRERQALRQALSQ
DPQNFVDEIRNETDHMIDASVRYLGHTRAPLVLLPLEDALGIEEQPNLPGTTDTHPNWRR
RLPGEAASLLDNAGAARRLELLAVARNQAYERDR
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgaagcgaacctggaaatcctcgccagccgcgcgggcctggccgtcgattggatc
gacgcaaacggccgtccgcaacgtgtgagcgccgacgccctgcgtgccgtgttgaaaggc
ctcggccacccggccgacaacgatgccgagatcgacgccagcctgcatgaactggaacag
gcgcaacacgacaaacacctgccgcccctactgactgtcgaaagcggcgacggcctcgac
ctggcgcgcttctttgcccctgacacgccctgccgagtgaacctggaacaaggtgaaacc
cttgagctgcgcctggacgacaacgcggtgctgccaggggtgatcgcgctcgggtatcac
caggtgcgtatcgctgaccaagcgttcacgctcgccgtggcgccccgccattgctacagc
gtggccgaagcggtcgatacccaccctgcccgcgcctggggcctcagtgcccagctgtat
tcgctgcggcgtctcggcgatggcggtttcggcgatacccaggccctggaaaacctggtg
cgcgccgctgccgaacgcggcgccgatgcgttggcgatcagcccgatgcacgcgatgttc
agcgccaacaccggcagctacagcccctactcgccgtccagccgcctgtttctcaacagc
ctttacgcctcgcccgccagcatccttggcgaacgggaagtgcgtgacgccattgaggcc
ctgggcctggacgaagaactgcaccggctcgaacaggacacgctgatcgactggccggcc
gcggccaacgccaaacagcgcctgctgcgcgcactgtatgaagactttcgccacggccat
cacccacagcacgccgacttcctgagctttcgccaggccggtggcgaagccctggaaaac
cattgccgttttgaggccgtacaagcgatgcgcgccgctgccggggaagacctcgactgg
cgccactggcccgaggactggcgcacgccgcagagcccggcactggcgcaatttgccgag
gataaccgcgacgaaatcggcttctacgccttcagccaatggctgatcgcgcgctgcctg
gcacgtgcgcaacaagccgcacgcggcagcggcatgggcgtgggcctgatcgccgacctg
gccgtgggcgccgacggcggtggcagccaggcctggagccgccaggatgaactgctcgcc
gacctcaccgtgggcgcgccgccggatattctcaaccgtgcaggccagggctggggcatt
tccgcgttctctccggaaggcctcaagcgcaacggctttcgtgccttcatcgagatgctg
cgcgccaatttcgcccatgccggtggcctgcgcatcgaccatgtgatgggcctgcagcgt
ctgtgggtaatccccatgaacgcctcgccgcgcgaaggggcttatctgtattttccggtg
gacgacatgctgcgtctgctggcgctggagtcgcaccgccaccaggccatcgtgctgggc
gaagacctcggcaccgttcccgacggcttgcgggaaaaactgagcagccgctccatcctc
ggcatgcgcgtgctgttgttcgaacagaaccatgagggccggttcacgccgattctcgac
tggccggacaacgccctggcgaccaccagtacccacgatctgcccaccctcaatggttgg
tggcacagccgcgatatcgactggaacgtccagctcggcctgatcgacgcccccaccgtg
gagcaatggagcgagcaccgcctgcgcgaacgccaggcgctgcgccaggccctcagccag
gacccgcagaacttcgtcgacgagatccgcaacgaaaccgatcacatgatcgacgctagc
gtgcgttacctgggccacacccgtgcgccgctggtgttgctgccgctggaagatgcgctg
ggcatcgaagaacaacccaacctgcccggcaccaccgatacccatcccaattggcgccgc
cgtctgccgggcgaggccgcgagcctgctcgacaatgccggcgccgcgcgtcgcctggaa
ctgctggccgtggcgcgcaaccaagcctatgagcgtgaccgatga

DBGET integrated database retrieval system