KEGG   Pseudomonas poae: H045_09310Help
Entry
H045_09310        CDS       T02456                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ppz  Pseudomonas poae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    H045_09310
Enzymes [BR:ppz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     H045_09310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2108768..2110852
Genome map
AA seq 694 aa AA seqDB search
MSEANLEILASRAGLAVDWIDANGRPQRVSADALRAVLKGLGHPADNDAEIDASLHELEQ
AQHDKHLPPLLTVESGDGLDLARFFAPDTPCRVNLEQGETLELRLDDNAVLPGVIALGYH
QVRIADQAFTLAVAPRHCYSVAEAVDTHPARAWGLSAQLYSLRRLGDGGFGDTQALENLV
RAAAERGADALAISPMHAMFSANTGSYSPYSPSSRLFLNSLYASPASILGEREVRDAIEA
LGLDEELHRLEQDTLIDWPAAANAKQRLLRALYEDFRHGHHPQHADFLSFRQAGGEALEN
HCRFEAVQAMRAAAGEDLDWRHWPEDWRTPQSPALAQFAEDNRDEIGFYAFSQWLIARCL
ARAQQAARGSGMGVGLIADLAVGADGGGSQAWSRQDELLADLTVGAPPDILNRAGQGWGI
SAFSPEGLKRNGFRAFIEMLRANFAHAGGLRIDHVMGLQRLWVIPMNASPREGAYLYFPV
DDMLRLLALESHRHQAIVLGEDLGTVPDGLREKLSSRSILGMRVLLFEQNHEGRFTPILD
WPDNALATTSTHDLPTLNGWWHSRDIDWNVQLGLIDAPTVEQWSEHRLRERQALRQALSQ
DPQNFVDEIRNETDHMIDASVRYLGHTRAPLVLLPLEDALGIEEQPNLPGTTDTHPNWRR
RLPGEAASLLDNAGAARRLELLAVARNQAYERDR
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgaagcgaacctggaaatcctcgccagccgcgcgggcctggccgtcgattggatc
gacgcaaacggccgtccgcaacgtgtgagcgccgacgccctgcgtgccgtgttgaaaggc
ctcggccacccggccgacaacgatgccgagatcgacgccagcctgcatgaactggaacag
gcgcaacacgacaaacacctgccgcccctactgactgtcgaaagcggcgacggcctcgac
ctggcgcgcttctttgcccctgacacgccctgccgagtgaacctggaacaaggtgaaacc
cttgagctgcgcctggacgacaacgcggtgctgccaggggtgatcgcgctcgggtatcac
caggtgcgtatcgctgaccaagcgttcacgctcgccgtggcgccccgccattgctacagc
gtggccgaagcggtcgatacccaccctgcccgcgcctggggcctcagtgcccagctgtat
tcgctgcggcgtctcggcgatggcggtttcggcgatacccaggccctggaaaacctggtg
cgcgccgctgccgaacgcggcgccgatgcgttggcgatcagcccgatgcacgcgatgttc
agcgccaacaccggcagctacagcccctactcgccgtccagccgcctgtttctcaacagc
ctttacgcctcgcccgccagcatccttggcgaacgggaagtgcgtgacgccattgaggcc
ctgggcctggacgaagaactgcaccggctcgaacaggacacgctgatcgactggccggcc
gcggccaacgccaaacagcgcctgctgcgcgcactgtatgaagactttcgccacggccat
cacccacagcacgccgacttcctgagctttcgccaggccggtggcgaagccctggaaaac
cattgccgttttgaggccgtacaagcgatgcgcgccgctgccggggaagacctcgactgg
cgccactggcccgaggactggcgcacgccgcagagcccggcactggcgcaatttgccgag
gataaccgcgacgaaatcggcttctacgccttcagccaatggctgatcgcgcgctgcctg
gcacgtgcgcaacaagccgcacgcggcagcggcatgggcgtgggcctgatcgccgacctg
gccgtgggcgccgacggcggtggcagccaggcctggagccgccaggatgaactgctcgcc
gacctcaccgtgggcgcgccgccggatattctcaaccgtgcaggccagggctggggcatt
tccgcgttctctccggaaggcctcaagcgcaacggctttcgtgccttcatcgagatgctg
cgcgccaatttcgcccatgccggtggcctgcgcatcgaccatgtgatgggcctgcagcgt
ctgtgggtaatccccatgaacgcctcgccgcgcgaaggggcttatctgtattttccggtg
gacgacatgctgcgtctgctggcgctggagtcgcaccgccaccaggccatcgtgctgggc
gaagacctcggcaccgttcccgacggcttgcgggaaaaactgagcagccgctccatcctc
ggcatgcgcgtgctgttgttcgaacagaaccatgagggccggttcacgccgattctcgac
tggccggacaacgccctggcgaccaccagtacccacgatctgcccaccctcaatggttgg
tggcacagccgcgatatcgactggaacgtccagctcggcctgatcgacgcccccaccgtg
gagcaatggagcgagcaccgcctgcgcgaacgccaggcgctgcgccaggccctcagccag
gacccgcagaacttcgtcgacgagatccgcaacgaaaccgatcacatgatcgacgctagc
gtgcgttacctgggccacacccgtgcgccgctggtgttgctgccgctggaagatgcgctg
ggcatcgaagaacaacccaacctgcccggcaccaccgatacccatcccaattggcgccgc
cgtctgccgggcgaggccgcgagcctgctcgacaatgccggcgccgcgcgtcgcctggaa
ctgctggccgtggcgcgcaaccaagcctatgagcgtgaccgatga

DBGET integrated database retrieval system