KEGG   Pseudomonas poae: H045_10980Help
Entry
H045_10980        CDS       T02456                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
ppz  Pseudomonas poae
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:ppz00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ppz00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2547811..2549127
Genome map
AA seq 438 aa AA seqDB search
MPYFPGVEKVRFEGPDSDNPLAFRHYDANKLILGKPMREHLRMAVCYWHTFVWPGADVFG
SGTFKRPWQRSGDPMEVAIGKADAAFEFFAKLGVDYYSFHDTDVAPEGSSLKEYRNHFAQ
MVDHLERHQEQSGIKLLWGTANCFSNPRFAAGAASNPDPEVFAWAAAQVFSAMNATLRLK
GSNYVLWGGREGYETLLNTDLKREREQLGRFMRMVVEHKHKIGFKGDLLIEPKPQEPTKH
QYDYDSATVFGFLHEYGLEHEIKVNIEANHATLAGHSFHHEIATAVSLGIFGSIDANRGD
PQNGWDTDQFPNSVEEMTLATYEILKADGFRNGGYNFDSKVRRQSLDEVDLFHGHVAAMD
VLALSLERAAAMVQNDTLQQFKDQRYAGWQQPLGQAVLAGEFSLESLAEHAFTHELNPQA
VSGRQEMLEGVVNRFIYR
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgccgtacttccccggtgtcgagaaggttcgcttcgaaggcccagacagcgacaatccc
ctcgcctttcgccattacgatgccaacaagctgatcctcggcaaacccatgcgcgaacac
ctgcgcatggccgtctgttattggcacacctttgtatggccgggcgcggatgtgtttggc
tcaggcacgttcaagcggccgtggcagcgcagcggtgatccgatggaggtcgccattggc
aaggctgatgcggccttcgagttcttcgccaagctgggcgtcgattactacagttttcac
gacaccgatgtggcgcccgagggcagctcgctcaaggaataccgcaaccactttgcgcag
atggtcgaccatctggagcgccatcaggagcagagcggcatcaagctgctgtggggcacc
gccaattgcttcagcaatccgcgcttcgccgctggcgccgcgagcaacccggaccccgag
gtgtttgcctgggccgccgcccaggtgttcagtgcgatgaacgccacgctgcgcctcaag
ggctccaactatgtgctgtggggcggccgtgaaggctatgaaaccctgctcaacaccgac
ctaaaacgcgagcgtgaacagctcggccgtttcatgcgcatggtggtggagcacaagcac
aagatcggcttcaagggcgacctgttgattgagcccaagccccaggagccgaccaagcat
cagtacgattacgacagcgccacggtgttcggcttcctgcacgagtacggcctggagcat
gagatcaaggtcaatatcgaggccaaccacgcaacgttggccgggcacagttttcaccat
gaaatcgcgacggccgtgtcattgggcattttcggcagtatcgacgccaaccgtggcgac
ccgcagaacggctgggacaccgaccagtttcccaacagcgtcgaggaaatgaccctggcc
acctacgaaatcctcaaggctgacggattccgtaacggcggctataactttgattccaag
gtgcgccgtcagagcctggacgaagtggacctgttccacgggcatgtcgcggccatggac
gtgctggccctgtcgctcgaacgggcggcggcgatggtgcagaacgacacgctgcagcag
ttcaaggatcagcgttatgccggctggcaacagccccttggccaggcagtgctggccggt
gaattcagccttgagtcgctggccgagcacgcgttcacccatgagctcaacccgcaggcg
gtaagtgggcggcaggagatgctggagggtgtggtcaaccggtttatctatcggtga

DBGET integrated database retrieval system