KEGG   Pseudomonas poae: H045_11275Help
Entry
H045_11275        CDS       T02456                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ppz  Pseudomonas poae
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    H045_11275
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    H045_11275
Enzymes [BR:ppz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     H045_11275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2608816..2610141
Genome map
AA seq 441 aa AA seqDB search
MALTREQQIAALEKDWAENPRWKGVTRAYSAADVVRLRGSVQPEHTFAKLGAEKLWNLVT
QGAKPSFRPDKDFVNCMGALTGGQAVQQVKAGIQAIYLSGWQVAADNNSAESMYPDQSLY
PVDSVPTVVKRINNSFRRADQIQWKAGKGPGDEGYIDYFAPIVADAEAGFGGVLNAYELM
KSMIEAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLTAARLAADVAGTPTIILAR
TDANAADLLTSDCDPYDQPFVTGERTQEGFYKVRAGLDQAIARGLAYAPYADLIWCETAK
PDLDEARRFAEAIKKEYPDQLLSYNCSPSFNWKKNLDDATIAKFQRELSAMGYKHQFITL
AGIHNMWHSMFNLAHDYARNDMTAYVKLQEQEFADASKGYTFVAHQQEVGTGYFDDMTTV
IQGGTSSVTALKGSTEEEQFH
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggcactgacacgcgaacagcaaattgcagccctcgaaaaagactgggctgaaaaccca
cgctggaaaggcgtgacccgcgcttattcggctgctgacgtcgtccgcctgcgcggctcg
gttcaacctgagcacacctttgccaaactcggcgccgagaagctgtggaacctggtgact
cagggcgccaagccgtccttccgccccgacaaggatttcgtcaactgcatgggcgccctc
accggcggtcaggctgtgcagcaggtaaaagccggaatccaggcgatctacctgtccggc
tggcaagtggcggcggacaacaactccgccgaatccatgtaccccgaccaatcgctgtac
ccggtggactcggtgccaaccgtggtcaagcgcatcaacaactcgttccgtcgtgccgac
cagatccagtggaaggccggcaaaggcccgggcgatgagggctacatcgactacttcgcg
ccaatcgtggcggacgccgaagccggttttggcggcgtgctcaacgcctacgaactgatg
aagagcatgatcgaggcaggcgctgccggcgtgcacttcgaagaccagttggcctcggtg
aaaaaatgcggccacatgggtggcaaggtactggttcccactcaggaggctgtgcaaaag
ctgaccgccgcgcgcctggccgctgacgtggctggcaccccgaccatcatcctcgcccgc
accgatgccaacgcagctgacttgctcacgtccgactgcgacccgtacgaccaaccgttc
gtgaccggcgagcgcactcaggaaggcttttacaaggtgcgcgccggtctggaccaggcg
atcgcccgtggcctggcctacgcgccctatgccgacctgatctggtgcgaaaccgccaag
ccggacctggatgaggcccgtcgtttcgccgaagcgatcaaaaaggaataccccgaccag
ttgctgtcctacaactgttcgccgtcctttaactggaagaagaacctggacgacgcgacc
atcgccaaattccagcgcgagctgtcagccatgggctacaagcaccagttcatcaccctg
gccggcattcacaacatgtggcacagcatgttcaacctggcgcacgactacgcccgcaac
gacatgaccgcctacgtgaaactgcaggaacaggaattcgcggacgcatccaagggttac
acctttgtggcgcaccagcaggaagtgggcaccggctacttcgacgacatgaccaccgtg
atccagggcggcacttcgtcggtgactgcgctgaagggttcgactgaggaagaacagttc
cactaa

DBGET integrated database retrieval system