KEGG   Pseudomonas poae: H045_11275Help
Entry
H045_11275        CDS       T02456                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ppz  Pseudomonas poae
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ppz01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:ppz00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2608816..2610141
Genome map
AA seq 441 aa AA seqDB search
MALTREQQIAALEKDWAENPRWKGVTRAYSAADVVRLRGSVQPEHTFAKLGAEKLWNLVT
QGAKPSFRPDKDFVNCMGALTGGQAVQQVKAGIQAIYLSGWQVAADNNSAESMYPDQSLY
PVDSVPTVVKRINNSFRRADQIQWKAGKGPGDEGYIDYFAPIVADAEAGFGGVLNAYELM
KSMIEAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLTAARLAADVAGTPTIILAR
TDANAADLLTSDCDPYDQPFVTGERTQEGFYKVRAGLDQAIARGLAYAPYADLIWCETAK
PDLDEARRFAEAIKKEYPDQLLSYNCSPSFNWKKNLDDATIAKFQRELSAMGYKHQFITL
AGIHNMWHSMFNLAHDYARNDMTAYVKLQEQEFADASKGYTFVAHQQEVGTGYFDDMTTV
IQGGTSSVTALKGSTEEEQFH
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggcactgacacgcgaacagcaaattgcagccctcgaaaaagactgggctgaaaaccca
cgctggaaaggcgtgacccgcgcttattcggctgctgacgtcgtccgcctgcgcggctcg
gttcaacctgagcacacctttgccaaactcggcgccgagaagctgtggaacctggtgact
cagggcgccaagccgtccttccgccccgacaaggatttcgtcaactgcatgggcgccctc
accggcggtcaggctgtgcagcaggtaaaagccggaatccaggcgatctacctgtccggc
tggcaagtggcggcggacaacaactccgccgaatccatgtaccccgaccaatcgctgtac
ccggtggactcggtgccaaccgtggtcaagcgcatcaacaactcgttccgtcgtgccgac
cagatccagtggaaggccggcaaaggcccgggcgatgagggctacatcgactacttcgcg
ccaatcgtggcggacgccgaagccggttttggcggcgtgctcaacgcctacgaactgatg
aagagcatgatcgaggcaggcgctgccggcgtgcacttcgaagaccagttggcctcggtg
aaaaaatgcggccacatgggtggcaaggtactggttcccactcaggaggctgtgcaaaag
ctgaccgccgcgcgcctggccgctgacgtggctggcaccccgaccatcatcctcgcccgc
accgatgccaacgcagctgacttgctcacgtccgactgcgacccgtacgaccaaccgttc
gtgaccggcgagcgcactcaggaaggcttttacaaggtgcgcgccggtctggaccaggcg
atcgcccgtggcctggcctacgcgccctatgccgacctgatctggtgcgaaaccgccaag
ccggacctggatgaggcccgtcgtttcgccgaagcgatcaaaaaggaataccccgaccag
ttgctgtcctacaactgttcgccgtcctttaactggaagaagaacctggacgacgcgacc
atcgccaaattccagcgcgagctgtcagccatgggctacaagcaccagttcatcaccctg
gccggcattcacaacatgtggcacagcatgttcaacctggcgcacgactacgcccgcaac
gacatgaccgcctacgtgaaactgcaggaacaggaattcgcggacgcatccaagggttac
acctttgtggcgcaccagcaggaagtgggcaccggctacttcgacgacatgaccaccgtg
atccagggcggcacttcgtcggtgactgcgctgaagggttcgactgaggaagaacagttc
cactaa

DBGET integrated database retrieval system