KEGG   Pseudomonas poae: H045_11275Help
Entry
H045_11275        CDS       T02456                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
ppz  Pseudomonas poae
Pathway
ppz00630  Glyoxylate and dicarboxylate metabolism
ppz01100  Metabolic pathways
ppz01110  Biosynthesis of secondary metabolites
ppz01120  Microbial metabolism in diverse environments
ppz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppz00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    H045_11275
Enzymes [BR:ppz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     H045_11275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AGE26320
Position
2608816..2610141
Genome map
AA seq 441 aa AA seqDB search
MALTREQQIAALEKDWAENPRWKGVTRAYSAADVVRLRGSVQPEHTFAKLGAEKLWNLVT
QGAKPSFRPDKDFVNCMGALTGGQAVQQVKAGIQAIYLSGWQVAADNNSAESMYPDQSLY
PVDSVPTVVKRINNSFRRADQIQWKAGKGPGDEGYIDYFAPIVADAEAGFGGVLNAYELM
KSMIEAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLTAARLAADVAGTPTIILAR
TDANAADLLTSDCDPYDQPFVTGERTQEGFYKVRAGLDQAIARGLAYAPYADLIWCETAK
PDLDEARRFAEAIKKEYPDQLLSYNCSPSFNWKKNLDDATIAKFQRELSAMGYKHQFITL
AGIHNMWHSMFNLAHDYARNDMTAYVKLQEQEFADASKGYTFVAHQQEVGTGYFDDMTTV
IQGGTSSVTALKGSTEEEQFH
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggcactgacacgcgaacagcaaattgcagccctcgaaaaagactgggctgaaaaccca
cgctggaaaggcgtgacccgcgcttattcggctgctgacgtcgtccgcctgcgcggctcg
gttcaacctgagcacacctttgccaaactcggcgccgagaagctgtggaacctggtgact
cagggcgccaagccgtccttccgccccgacaaggatttcgtcaactgcatgggcgccctc
accggcggtcaggctgtgcagcaggtaaaagccggaatccaggcgatctacctgtccggc
tggcaagtggcggcggacaacaactccgccgaatccatgtaccccgaccaatcgctgtac
ccggtggactcggtgccaaccgtggtcaagcgcatcaacaactcgttccgtcgtgccgac
cagatccagtggaaggccggcaaaggcccgggcgatgagggctacatcgactacttcgcg
ccaatcgtggcggacgccgaagccggttttggcggcgtgctcaacgcctacgaactgatg
aagagcatgatcgaggcaggcgctgccggcgtgcacttcgaagaccagttggcctcggtg
aaaaaatgcggccacatgggtggcaaggtactggttcccactcaggaggctgtgcaaaag
ctgaccgccgcgcgcctggccgctgacgtggctggcaccccgaccatcatcctcgcccgc
accgatgccaacgcagctgacttgctcacgtccgactgcgacccgtacgaccaaccgttc
gtgaccggcgagcgcactcaggaaggcttttacaaggtgcgcgccggtctggaccaggcg
atcgcccgtggcctggcctacgcgccctatgccgacctgatctggtgcgaaaccgccaag
ccggacctggatgaggcccgtcgtttcgccgaagcgatcaaaaaggaataccccgaccag
ttgctgtcctacaactgttcgccgtcctttaactggaagaagaacctggacgacgcgacc
atcgccaaattccagcgcgagctgtcagccatgggctacaagcaccagttcatcaccctg
gccggcattcacaacatgtggcacagcatgttcaacctggcgcacgactacgcccgcaac
gacatgaccgcctacgtgaaactgcaggaacaggaattcgcggacgcatccaagggttac
acctttgtggcgcaccagcaggaagtgggcaccggctacttcgacgacatgaccaccgtg
atccagggcggcacttcgtcggtgactgcgctgaagggttcgactgaggaagaacagttc
cactaa

DBGET integrated database retrieval system