KEGG   Pseudomonas poae: H045_15865Help
Entry
H045_15865        CDS       T02456                                 

Definition
protein disulfide isomerase II
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
ppz  Pseudomonas poae
Brite
Enzymes [BR:ppz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     H045_15865
Secretion system [BR:ppz02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   H045_15865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3623109..3623840)
Genome map
AA seq 243 aa AA seqDB search
MRLIQIIAAAAIALVSSVAFADDAAEQTIRKSLANLQLDTPIESISASPMAGLYEVKLKG
SRVLYASADGQYIVQGYLFQLKDGKPVNLTEKAERLGVSKLINGIPVAETVVYPAIGETK
THITVFTDTTCPYCHKLHAEVPALNKLGVEVRYVAFPRQGLGSPGDEQLQAVWCSADKKA
AMDKMVDGKEIKAAKCANPVSKQFALGQSIGVNGTPAIVLADGQVIPGYQPAPQVAKLAL
NAK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttgatccagattattgccgccgcagccattgcgttggtttccagcgttgccttc
gccgatgacgccgccgagcagaccattcgcaagagcctggccaacctgcagctcgatacg
cccatcgaaagcatcagcgccagccccatggccggcttgtatgaagtcaagctcaagggc
agtcgcgtgctgtacgccagtgccgatggccagtacatcgtccagggctacctgttccag
ctcaaggatggcaagccggtcaacctgaccgagaaagccgaacgcctgggcgtctccaag
ttgatcaacggcattccggtggccgagaccgtggtgtacccggcaatcggcgagaccaag
acccacatcaccgtgtttaccgacaccacctgcccgtactgccacaaactgcacgccgaa
gtgccggcgctgaacaagctgggtgtcgaggtgcgttatgtggcgttcccgcgtcagggc
ctgggctcgccgggtgacgagcagttgcaggcggtctggtgctcggctgacaagaaagcc
gccatggacaagatggtcgatggcaaggaaatcaaggcggcaaaatgtgccaatccggtt
tccaaacagtttgccctcggtcagtccatcggcgtgaacggtacaccggccatcgttttg
gctgacggtcaggtgattccgggctaccagccggcaccgcaagttgccaaactggcgttg
aatgccaaataa

DBGET integrated database retrieval system